(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5128

AL939122.SCO5128     Location/Qualifiers
FT   CDS             204738..207065
FT                   /transl_table=11
FT                   /gene="SCO5128"
FT                   /gene_synonym="SC9E12.13"
FT                   /product="putative membrane protein"
FT                   /note="SC9E12.13, possible membrane protein, len: 775 aa;
FT                   highly hydrophilic. Contains possible hydrophobic membrane
FT                   spanning region"
FT                   /db_xref="GOA:Q9F342"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F342"
FT                   /protein_id="CAC05758.1"
FT                   /translation="MSRETDSSSSGPHGRGGAAYPSGTPPYGTPTASDAGADAGRSATR
FT                   PEERKTETTLTTRIRINIPGSRPIPPVVVRKPVADGEDTADSTETTGERPAPAPSAAAP
FT                   GAAAPEAPAESAQSAQSAEEKPTSDWFAPRKSGPGKGTQGGGSTNGAGLPAGSAPTAGT
FT                   PGAAGARGAGPAGASGAGARPGGGSGRPGGVVGSMNAPGGARSGSAGGGARSGATGGPV
FT                   APGHGGGTGSFDVTEALAAGPLGGNGNGNGNGNGSGPRPGTDAGGEPRRDDLPYFAGEG
FT                   RADQAPGGQQNGLNGQSPYGTGPQGPAGPTSGPATGDSRLTPPPAGDLGGLGTAGGPAA
FT                   PGTQREPAPNGLRGPGSLGGPGGPGGPGRPAGSGPDAARLGPGGGLSDDTAILTPQRPV
FT                   PPGAANPDNISGNTVTSGIPVVPGERTAPFPAGSGDGPRPHTPPKLPEPVSAPPASSAK
FT                   PAKKKGRRKLPLLVVGVVVVAGVTYGAGLLMNRSDVPKGTTVLGVDIGGGTRDDAVEKL
FT                   DKALGARAAKPLKLTVGGDTVSLKPDQAGLQLDTQTTASSAATSDYNPMSVIGSLFGQK
FT                   RVVEPAMPVDEEKLHAALEDAAGGAGSATEGSIRFESGKAVPVYGKAGQGIDVAKSTEA
FT                   VQAAYRAQVETGTATAVNVPTTAKQPTVAKAEVDRMLKEFAEPAMSARVTVQTDAAHSI
FT                   QFSPEKSLWKFLRVTAVDGKLVDKPDLNALKELYGQTFDGVLIARANGEKTAVTPQDVY
FT                   GAMRQALKSKTDRVAVIDTNPS"
     MSRETDSSSS GPHGRGGAAY PSGTPPYGTP TASDAGADAG RSATRPEERK TETTLTTRIR        60
     INIPGSRPIP PVVVRKPVAD GEDTADSTET TGERPAPAPS AAAPGAAAPE APAESAQSAQ       120
     SAEEKPTSDW FAPRKSGPGK GTQGGGSTNG AGLPAGSAPT AGTPGAAGAR GAGPAGASGA       180
     GARPGGGSGR PGGVVGSMNA PGGARSGSAG GGARSGATGG PVAPGHGGGT GSFDVTEALA       240
     AGPLGGNGNG NGNGNGSGPR PGTDAGGEPR RDDLPYFAGE GRADQAPGGQ QNGLNGQSPY       300
     GTGPQGPAGP TSGPATGDSR LTPPPAGDLG GLGTAGGPAA PGTQREPAPN GLRGPGSLGG       360
     PGGPGGPGRP AGSGPDAARL GPGGGLSDDT AILTPQRPVP PGAANPDNIS GNTVTSGIPV       420
     VPGERTAPFP AGSGDGPRPH TPPKLPEPVS APPASSAKPA KKKGRRKLPL LVVGVVVVAG       480
     VTYGAGLLMN RSDVPKGTTV LGVDIGGGTR DDAVEKLDKA LGARAAKPLK LTVGGDTVSL       540
     KPDQAGLQLD TQTTASSAAT SDYNPMSVIG SLFGQKRVVE PAMPVDEEKL HAALEDAAGG       600
     AGSATEGSIR FESGKAVPVY GKAGQGIDVA KSTEAVQAAY RAQVETGTAT AVNVPTTAKQ       660
     PTVAKAEVDR MLKEFAEPAM SARVTVQTDA AHSIQFSPEK SLWKFLRVTA VDGKLVDKPD       720
     LNALKELYGQ TFDGVLIARA NGEKTAVTPQ DVYGAMRQAL KSKTDRVAVI DTNPS            775
//

If you have problems or comments...

PBIL Back to PBIL home page