(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5131

AL939122.SCO5131     Location/Qualifiers
FT   CDS             208902..210068
FT                   /transl_table=11
FT                   /gene="SCO5131"
FT                   /gene_synonym="SC9E12.16"
FT                   /product="putative two-component system sensor kinase"
FT                   /note="SC9E12.16, possible two-component system sensor
FT                   kinase, len: 388 aa; similar to TR:CAB88185 (EMBL:AL352972)
FT                   Streptomyces coelicolor putative two-component system
FT                   sensor kinase SCC30.15, 409 aa; fasta scores: opt: 773
FT                   z-score: 840.8 E(): 0; 41.9% identity in 389 aa overlap.
FT                   Contains possible hydrophobic membrane spanning regions at
FT                   N-terminal domain"
FT                   /db_xref="GOA:Q9F339"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F339"
FT                   /protein_id="CAC05761.1"
FT                   /translation="MSGVGIGQRPENRRQKTVKVMWTAIWLAYLGAPVSDLLHGGHAVG
FT                   VQVLGWIGLVAFVVWYMLLLFRTGRGERTRLVLGSLAVLAAESTLLALTLGREWLVLFV
FT                   YVAIASGAALPLRLARWTIPGASALLTAMALVVPGGTSFIAGLLLPALLGGFAMTGVRE
FT                   LVRTTIALREARATVAQLAANEERLRLARDLHDLLGHSLSLITLKSELAGRMLPAHPDK
FT                   AAQQVADIEQVSRQALVDVREAVTGYRRARLAPELAGAKVALTAAGVDAELPGEPDPAH
FT                   LPEDSEAALAWALREAVTNVVRHSGARRCVVELLERQTLDGAVLELSVEDNGSGGPASA
FT                   NAPGNGLTGLAERLEKAGGTLEAGGSRRGFRLVARVPVGAATDVGSGA"
     MSGVGIGQRP ENRRQKTVKV MWTAIWLAYL GAPVSDLLHG GHAVGVQVLG WIGLVAFVVW        60
     YMLLLFRTGR GERTRLVLGS LAVLAAESTL LALTLGREWL VLFVYVAIAS GAALPLRLAR       120
     WTIPGASALL TAMALVVPGG TSFIAGLLLP ALLGGFAMTG VRELVRTTIA LREARATVAQ       180
     LAANEERLRL ARDLHDLLGH SLSLITLKSE LAGRMLPAHP DKAAQQVADI EQVSRQALVD       240
     VREAVTGYRR ARLAPELAGA KVALTAAGVD AELPGEPDPA HLPEDSEAAL AWALREAVTN       300
     VVRHSGARRC VVELLERQTL DGAVLELSVE DNGSGGPASA NAPGNGLTGL AERLEKAGGT       360
     LEAGGSRRGF RLVARVPVGA ATDVGSGA                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page