(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5132

AL939122.SCO5132     Location/Qualifiers
FT   CDS             210065..210679
FT                   /transl_table=11
FT                   /gene="SCO5132"
FT                   /gene_synonym="SC9E12.17"
FT                   /product="putative two-component system response regulator"
FT                   /note="SC9E12.17, possible two-component system response
FT                   regulator, len: 204 aa; similar to TR:CAB88186
FT                   (EMBL:AL352972) Streptomyces coelicolor  putative
FT                   two-component response regulator SCC30.16, 210 aa; fasta
FT                   scores: opt: 822 z-score: 928.1 E(): 0; 63.0% identity in
FT                   200 aa overlap. Contains Pfam matches to entries PF00072
FT                   response_reg, Response regulator receiver domain and
FT                   PF00196 GerE, Bacterial regulatory proteins, luxR family.
FT                   Also contains possible helix-turn-helix motif at residues
FT                   159..180 (+5.28 SD)"
FT                   /db_xref="GOA:Q9F338"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F338"
FT                   /protein_id="CAC05762.1"
FT                   /translation="MSRTIKVLLAEDQAMVREALAALLGLEEDIEVVAQVARGDEVLDA
FT                   ARAHGVDVALLDIEMPGATGIEAAALVHRELPAVKLVVLTTFGRPGYLRSAMESGADAF
FT                   LVKDAPAAQLAEAVRRVLAGERVIDPTLAAAALAEGANPLTDREREILRAAADGSTNAE
FT                   LASALHLSQGTVRNYLSTAIQKLAVRNRAEAVRVARNKGWL"
     MSRTIKVLLA EDQAMVREAL AALLGLEEDI EVVAQVARGD EVLDAARAHG VDVALLDIEM        60
     PGATGIEAAA LVHRELPAVK LVVLTTFGRP GYLRSAMESG ADAFLVKDAP AAQLAEAVRR       120
     VLAGERVIDP TLAAAALAEG ANPLTDRERE ILRAAADGST NAELASALHL SQGTVRNYLS       180
     TAIQKLAVRN RAEAVRVARN KGWL                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page