(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5135

AL939122.SCO5135     Location/Qualifiers
FT   CDS             212902..213222
FT                   /transl_table=11
FT                   /gene="SCO5135"
FT                   /gene_synonym="fdxA1"
FT                   /gene_synonym="SC9E12.20"
FT                   /product="ferredoxin"
FT                   /note="SC9E12.20, fdxA1, ferredoxin, len: 106 aa; similar
FT                   to SW:FER_SACER (EMBL:M61119) Saccharopolyspora erythraea
FT                   ferredoxin FdxA, 105 aa; fasta scores: opt: 618 z-score:
FT                   759.8 E(): 0; 78.1% identity in 105 aa overlap and to
FT                   TR:CAC04216 (EMBL:AL391515) Streptomyces coelicolor FdxA,
FT                   ferredoxin, 129 aa; fasta scores: opt: 520 z-score: 702.1
FT                   E(): 1.8e-33; 65.7% identity in 105 aa overlap. Contains
FT                   Pfam match to entry PF00037 fer4, 4Fe-4S binding domain and
FT                   match to Prosite entry PS00198 4Fe-4S ferredoxins,
FT                   iron-sulfur binding region signature"
FT                   /db_xref="GOA:Q9F335"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q9F335"
FT                   /protein_id="CAC05765.1"
FT                   /translation="MTYVIAQPCVDVKDKACIEECPVDCIYEGQRSLYIHPDECVDCGA
FT                   CEPVCPVEAIFYEDDTPEEWKDYYKANVEFFDELGSPGGASKLGLIERDHPFVAALPPQ
FT                   NQ"
     MTYVIAQPCV DVKDKACIEE CPVDCIYEGQ RSLYIHPDEC VDCGACEPVC PVEAIFYEDD        60
     TPEEWKDYYK ANVEFFDELG SPGGASKLGL IERDHPFVAA LPPQNQ                      106
//

If you have problems or comments...

PBIL Back to PBIL home page