(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5138

AL939122.SCO5138     Location/Qualifiers
FT   CDS             complement(215424..216392)
FT                   /transl_table=11
FT                   /gene="SCO5138"
FT                   /gene_synonym="SCP8.01c"
FT                   /gene_synonym="SC9E12.23c"
FT                   /product="putative membrane protein"
FT                   /note="SCP8.01c, possible membrane protein (fragment), len:
FT                   >86 aa. . Contains possible hydrophobic membrane spanning
FT                   region"
FT                   /note="SC9E12.23c, hypothetical protein (fragment), len:
FT                   >270 aa; similar to TR:Q9X867 (EMBL:AL049661) Streptomyces
FT                   coelicolor putative lipoprotein SCE134.12, 381 aa; fasta
FT                   scores: opt: 432 z-score: 481.0 E(): 2.5e-19; 41.2%
FT                   identity in 211 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CJS1"
FT                   /protein_id="CAD55224.1"
FT                   /translation="MLQPSPPRKRRGRLARSGAASMVLLAVAGYLAVQYVTGGAFAPGC
FT                   KVAGGKGGRTTYEFTPEQAVNAATITAVGTARKLPDRAVTIALAAALQESALRNLDHGD
FT                   KDSLGLFQQRPSQGWGKPEEIMDPAYSAGLFYDHLVEVPGYLDLPLTDAAQRVQRSAFP
FT                   DAYAKHEPDAELLAAALTGRSAATLTCVGRPGATPEKGPDAVRAALVRDFGHDVLRPAG
FT                   AEVGGDAASRRPATGSDERTVTLPVTGSTGSGPAREHVRRGWQLAHWAVANASSLHIQR
FT                   VTYAGREWTAGNTDSKWYPTGTEGAKGAERAAEAVRITSAR"
     MLQPSPPRKR RGRLARSGAA SMVLLAVAGY LAVQYVTGGA FAPGCKVAGG KGGRTTYEFT        60
     PEQAVNAATI TAVGTARKLP DRAVTIALAA ALQESALRNL DHGDKDSLGL FQQRPSQGWG       120
     KPEEIMDPAY SAGLFYDHLV EVPGYLDLPL TDAAQRVQRS AFPDAYAKHE PDAELLAAAL       180
     TGRSAATLTC VGRPGATPEK GPDAVRAALV RDFGHDVLRP AGAEVGGDAA SRRPATGSDE       240
     RTVTLPVTGS TGSGPAREHV RRGWQLAHWA VANASSLHIQ RVTYAGREWT AGNTDSKWYP       300
     TGTEGAKGAE RAAEAVRITS AR                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page