(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5139

AL939122.SCO5139     Location/Qualifiers
FT   CDS             216476..217555
FT                   /transl_table=11
FT                   /gene="SCO5139"
FT                   /gene_synonym="dapE"
FT                   /gene_synonym="SCP8.02"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="SCP8.02, dapE, succinyl-diaminopimelate
FT                   desuccinylase, len: 359 aa; highly similar to SW:DAPE_CORGL
FT                   (EMBL:X81379) Corynebacterium glutamicum
FT                   succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) DapE,
FT                   369 aa; fasta scores: opt: 1189 z-score: 1383.5 E(): 0;
FT                   52.1% identity in 361 aa overlap. Contains Pfam match to
FT                   entry PF01546 Peptidase_M20, Peptidase family M20/M25/M40"
FT                   /db_xref="GOA:Q9FBL9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010174"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL9"
FT                   /protein_id="CAC01340.1"
FT                   /translation="MADTPLDLTLDAAELTARLVDFPSESGTEKPLADAIESALRTLPH
FT                   LSVERYGNNLVARTGLGRAERVILAGHIDTVPIAGNVPSRLDEDGVLWGCGTCDMKAGV
FT                   AVQLRIAATVPAPNRDLTFVFYDNEEVAAELNGLKHVAEAHPEWLEGDFAVLLEPSDGQ
FT                   VEGGCQGTLRVLLKTAGERAHSARSWMGSNAIHAAAPILARLAAYEPRYPVIDGLEYRE
FT                   GLNAVGITGGVAGNVIPDECVVTVNFRYAPDRSPEEALAHVREVFDGCGVTDFVVDDHS
FT                   GAALPGLSHPAAAAFIEAVGGTPQPKYGWTDVSRFSALGVPAVNYGPGNPHLAHKRDER
FT                   VEVAKILAGEERLRSWLTA"
     MADTPLDLTL DAAELTARLV DFPSESGTEK PLADAIESAL RTLPHLSVER YGNNLVARTG        60
     LGRAERVILA GHIDTVPIAG NVPSRLDEDG VLWGCGTCDM KAGVAVQLRI AATVPAPNRD       120
     LTFVFYDNEE VAAELNGLKH VAEAHPEWLE GDFAVLLEPS DGQVEGGCQG TLRVLLKTAG       180
     ERAHSARSWM GSNAIHAAAP ILARLAAYEP RYPVIDGLEY REGLNAVGIT GGVAGNVIPD       240
     ECVVTVNFRY APDRSPEEAL AHVREVFDGC GVTDFVVDDH SGAALPGLSH PAAAAFIEAV       300
     GGTPQPKYGW TDVSRFSALG VPAVNYGPGN PHLAHKRDER VEVAKILAGE ERLRSWLTA        359
//

If you have problems or comments...

PBIL Back to PBIL home page