(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5143

AL939122.SCO5143     Location/Qualifiers
FT   CDS             220067..220651
FT                   /transl_table=11
FT                   /gene="SCO5143"
FT                   /gene_synonym="tag"
FT                   /gene_synonym="SCP8.06"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /note="SCP8.06, tag, DNA-3-methyladenine glycosylase I,
FT                   len: 194 aa; highly similar to SW:3MG1_ECOLI (EMBL:J02606)
FT                   Escherichia coli DNA-3-methyladenine glycosylase I (EC
FT                   3.2.2.20) Tag, 187 aa; fasta scores: opt: 529 z-score:
FT                   636.5 E(): 5.5e-28; 45.2% identity in 177 aa overlap"
FT                   /db_xref="GOA:Q9FBL5"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL5"
FT                   /protein_id="CAC01344.1"
FT                   /translation="MSAGEAVAGPDGALRCPWALSTADYVTYHDDEWGRPVHGDDALYE
FT                   RLSLEAFQSGLSWITILRRRTGFRSAFAGFEIAKVAAFTDTDRERLLADTGIIRNRAKI
FT                   DATLTNARVLAEWAPGDLDELIWSHAPDPAGRPAPKTLTDVPAVTPESTALSKALKKRG
FT                   LRFVGPTTAYALMQACGLVDDHLAACVARRP"
     MSAGEAVAGP DGALRCPWAL STADYVTYHD DEWGRPVHGD DALYERLSLE AFQSGLSWIT        60
     ILRRRTGFRS AFAGFEIAKV AAFTDTDRER LLADTGIIRN RAKIDATLTN ARVLAEWAPG       120
     DLDELIWSHA PDPAGRPAPK TLTDVPAVTP ESTALSKALK KRGLRFVGPT TAYALMQACG       180
     LVDDHLAACV ARRP                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page