(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5144

AL939122.SCO5144     Location/Qualifiers
FT   CDS             complement(221303..222106)
FT                   /transl_table=11
FT                   /gene="SCO5144"
FT                   /gene_synonym="SCP8.07c"
FT                   /product=" putative acyl CoA isomerase"
FT                   /note="SCP8.07c, probable acyl CoA isomerase, len: 267 aa;
FT                   highly similar to TR:AAF73478 (EMBL:AF268489) Streptomyces
FT                   collinus 2-cyclohexenylcarbonyl CoA isomerase ChcB, 269 aa;
FT                   fasta scores: opt: 1476 z-score: 1623.5 E(): 0; 87.6%
FT                   identity in 266 aa overlap and to SW:CRT_CLOAB
FT                   (EMBL:U17110) Clostridium acetobutylicum
FT                   3-hydroxybutyryl-CoA dehydratase (EC 4.2.1.55) Crt, 261 aa;
FT                   fasta scores: opt: 426 z-score: 476.6 E(): 4.4e-19; 32.4%
FT                   identity in 259 aa overlap. Contains Pfam match to entry
FT                   PF00378 ECH, Enoyl-CoA hydratase/isomerase family and match
FT                   to Prosite entry PS00166 Enoyl-CoA hydratase/isomerase
FT                   signature"
FT                   /db_xref="GOA:Q9FBL4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL4"
FT                   /protein_id="CAC01345.1"
FT                   /translation="MADTVLYEVSDGLATITLNRPEAMNALNIETKVALRDAVRSAAAD
FT                   DAVRAVLLTAAGDRAFCVGQDLKEHIGLLAADRETGSGQTMSTVREHYNPIVRALAGAE
FT                   KPVVAAVNGVAAGAGLGFALAADYRIVADTAAFNTSFAGVALTADSGISWTLPRVVGPG
FT                   RAADLLLFPRSIRAQEAYELGIATRVVPAADLRAEAEKTARALAEGPTVAYAALKEAMA
FT                   YGLTHSLSETLDKEDELQSRAGASEDHAIAVRAFVEKGKPKYLGR"
     MADTVLYEVS DGLATITLNR PEAMNALNIE TKVALRDAVR SAAADDAVRA VLLTAAGDRA        60
     FCVGQDLKEH IGLLAADRET GSGQTMSTVR EHYNPIVRAL AGAEKPVVAA VNGVAAGAGL       120
     GFALAADYRI VADTAAFNTS FAGVALTADS GISWTLPRVV GPGRAADLLL FPRSIRAQEA       180
     YELGIATRVV PAADLRAEAE KTARALAEGP TVAYAALKEA MAYGLTHSLS ETLDKEDELQ       240
     SRAGASEDHA IAVRAFVEKG KPKYLGR                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page