(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5146

AL939122.SCO5146     Location/Qualifiers
FT   CDS             complement(222745..223269)
FT                   /transl_table=11
FT                   /gene="SCO5146"
FT                   /gene_synonym="SCP8.09c"
FT                   /product="putative methyltransferase"
FT                   /note="SCP8.09c, probable methyltransferase, len: 174 aa;
FT                   similar to SW:MDMC_STRMY (EMBL:M93958) Streptomyces
FT                   mycarofaciens O-methyltransferase (EC 2.1.1.-) MdmC, 221
FT                   aa; fasta scores: opt: 253 z-score: 313.8 E(): 5.2e-10;
FT                   31.5% identity in 178 aa overlap. Contains Pfam match to
FT                   entry PF01596 Methyltransf_3, O-methyltransferase"
FT                   /db_xref="GOA:Q9FBL2"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL2"
FT                   /protein_id="CAC01347.1"
FT                   /translation="MTPGTGSALGLLAAAVDAKAVAEIGTGCGVSGIHLLHGMRPDGVL
FT                   TTVDPEPEHQQFARHAFRAAGFASNRARFIPGRALDVLPRLADAGYDLVFCDGDRLEYL
FT                   DYLAESLRLLRPGGLVAFEGVFGAGRTIDSGPQPTEVLRVRELLRAVRESQELVPSLLP
FT                   VGDGLLCAVKR"
     MTPGTGSALG LLAAAVDAKA VAEIGTGCGV SGIHLLHGMR PDGVLTTVDP EPEHQQFARH        60
     AFRAAGFASN RARFIPGRAL DVLPRLADAG YDLVFCDGDR LEYLDYLAES LRLLRPGGLV       120
     AFEGVFGAGR TIDSGPQPTE VLRVRELLRA VRESQELVPS LLPVGDGLLC AVKR             174
//

If you have problems or comments...

PBIL Back to PBIL home page