(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5148

AL939122.SCO5148     Location/Qualifiers
FT   CDS             224358..225347
FT                   /transl_table=11
FT                   /gene="SCO5148"
FT                   /gene_synonym="SCP8.11"
FT                   /product="putative membrane protein"
FT                   /note="SCP8.11, possible membrane protein, len: 329 aa.
FT                   Contains possible hydrophobic membrane spanning region"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBL0"
FT                   /protein_id="CAC01349.1"
FT                   /translation="MSGSRPEPEGHLAEQHLGDRLSALVDGELGHDARERVLAHVATCP
FT                   KCKAEVDAQRRLKNVFAEAAPPAPSESFLARLQGLPGGGDSDGGGSPFSGLPGGFGASA
FT                   ASGVFGPRRDERFEFDYVPAGSHTPVLPSATSGRGFRIHEVGRHESDRSASRGLRFAFA
FT                   AAGAVSLAAIALGGVTLGTPDTTTEARGSGSGSNVTPLRTPGSAAATGSESQRRRTAGP
FT                   LLGQGQRALGDLPVASTTASAPLLPGMPAPAGGDARQQAVRALTTPVTAGAAAMSPLIR
FT                   PLEAVPPLSLSSWSAAPEVRPPGLLAAPDPAPSPYPAASPAASSSPLR"
     MSGSRPEPEG HLAEQHLGDR LSALVDGELG HDARERVLAH VATCPKCKAE VDAQRRLKNV        60
     FAEAAPPAPS ESFLARLQGL PGGGDSDGGG SPFSGLPGGF GASAASGVFG PRRDERFEFD       120
     YVPAGSHTPV LPSATSGRGF RIHEVGRHES DRSASRGLRF AFAAAGAVSL AAIALGGVTL       180
     GTPDTTTEAR GSGSGSNVTP LRTPGSAAAT GSESQRRRTA GPLLGQGQRA LGDLPVASTT       240
     ASAPLLPGMP APAGGDARQQ AVRALTTPVT AGAAAMSPLI RPLEAVPPLS LSSWSAAPEV       300
     RPPGLLAAPD PAPSPYPAAS PAASSSPLR                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page