(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5151

AL939122.SCO5151     Location/Qualifiers
FT   CDS             228255..229001
FT                   /transl_table=11
FT                   /gene="SCO5151"
FT                   /gene_synonym="SCP8.14"
FT                   /product="hypothetical protein SCP8.14"
FT                   /note="SCP8.14, unknown, len: 248 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK7"
FT                   /protein_id="CAC01352.1"
FT                   /translation="MRTGRVRPKGGGPFRSDESEEASGHMETTSRAVAQAPAAEGGPQS
FT                   PSGRRTVDGYLRAPFPWYGLDEAFTGRRWLMQIGTAADGAVEHGSIGHGDEPSVRNEHV
FT                   AGDEQDAKEKFAVVVTVAANPDRRSADGTGLLEATSVSSAAWLAGVGLLSFTWPGQMDH
FT                   SLRDDWLEQQTETAWVLADDLDGEDWTTLSLPVDGVPTPFHYRESEFGWVLAGSTEQGV
FT                   HLGAYGRGMSAYGLAFAVVKDVAAYA"
     MRTGRVRPKG GGPFRSDESE EASGHMETTS RAVAQAPAAE GGPQSPSGRR TVDGYLRAPF        60
     PWYGLDEAFT GRRWLMQIGT AADGAVEHGS IGHGDEPSVR NEHVAGDEQD AKEKFAVVVT       120
     VAANPDRRSA DGTGLLEATS VSSAAWLAGV GLLSFTWPGQ MDHSLRDDWL EQQTETAWVL       180
     ADDLDGEDWT TLSLPVDGVP TPFHYRESEF GWVLAGSTEQ GVHLGAYGRG MSAYGLAFAV       240
     VKDVAAYA                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page