(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5152

AL939122.SCO5152     Location/Qualifiers
FT   CDS             complement(229076..230209)
FT                   /transl_table=11
FT                   /gene="SCO5152"
FT                   /gene_synonym="SCP8.15c"
FT                   /product="putative ATP-binding protein"
FT                   /note="SCP8.15c, probable ATP-binding protein, len: 371 aa;
FT                   similar to SW:MRP_MYCTU (EMBL:Z98260) Mycobacterium
FT                   tuberculosis Mrp protein homolog MTV006.01c, 390 aa; fasta
FT                   scores: opt: 1650 z-score: 1730.0 E(): 0; 67.9% identity in
FT                   371 aa overlap and to SW:MRP_ECOLI (EMBL:U00007)
FT                   Escherichia coli Mrp protein, 379 aa; fasta scores: opt:
FT                   706 z-score: 744.5 E(): 0; 35.8% identity in 363 aa
FT                   overlap. Contains Pfam matches to entries PF01883 DUF59,
FT                   Domain of unknown function DUF59 and PF00142 fer4_NifH,
FT                   4Fe-4S iron sulfur cluster binding proteins, NifH/frxC
FT                   family and matches to Prosite entries PS00017
FT                   ATP/GTP-binding site motif A (P-loop) and PS01215 Mrp
FT                   family signature"
FT                   /db_xref="GOA:Q9FBK6"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK6"
FT                   /protein_id="CAC01353.1"
FT                   /translation="MATEDAVREALATVNDPEINRPITELGMVKSVEIGADGAVAVAVY
FT                   LTVSGCPMRDTITQRVSDAVSRVEGVTRVDVELDVMSDEQRKELATALRGGQTEREVPF
FT                   AKPGSLTRVYAVASGKGGVGKSSVTVNLAASMAADGLKVGVVDADIYGHSVPRMLGADG
FT                   RPTQVENMIMPPSAHGVKVISIGMFTPGNAPVVWRGPMLHRALQQFLADVYWGDLDVLL
FT                   LDLPPGTGDIAISVAQLVPNAEILVVTTPQQAAAEVAERAGAIAVQTHQKIVGVVENMS
FT                   GLPCPHCGEMVDVFGTGGGQTVADGLTRTTGASVPVLGAIPIDVRLREGGDEGKPVVLS
FT                   DPDSPAGAALRSIAGKLGGRQRGLSGLSLGITPKNKF"
     MATEDAVREA LATVNDPEIN RPITELGMVK SVEIGADGAV AVAVYLTVSG CPMRDTITQR        60
     VSDAVSRVEG VTRVDVELDV MSDEQRKELA TALRGGQTER EVPFAKPGSL TRVYAVASGK       120
     GGVGKSSVTV NLAASMAADG LKVGVVDADI YGHSVPRMLG ADGRPTQVEN MIMPPSAHGV       180
     KVISIGMFTP GNAPVVWRGP MLHRALQQFL ADVYWGDLDV LLLDLPPGTG DIAISVAQLV       240
     PNAEILVVTT PQQAAAEVAE RAGAIAVQTH QKIVGVVENM SGLPCPHCGE MVDVFGTGGG       300
     QTVADGLTRT TGASVPVLGA IPIDVRLREG GDEGKPVVLS DPDSPAGAAL RSIAGKLGGR       360
     QRGLSGLSLG ITPKNKF                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page