(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5155

AL939122.SCO5155     Location/Qualifiers
FT   CDS             232439..233170
FT                   /transl_table=11
FT                   /gene="SCO5155"
FT                   /gene_synonym="SCP8.18"
FT                   /product="putative lipoprotein"
FT                   /note="SCP8.18, possible lipoprotein, len: 243 aa; similar
FT                   to TR:CAB76294 (EMBL:AL158057) Streptomyces coelicolor
FT                   putative lipoprotein SC1G8.21c, 249 aa; fasta scores: opt:
FT                   238 z-score: 275.6 E(): 7e-08; 29.3% identity in 249 aa
FT                   overlap. Contains possible N-terminal region signal peptide
FT                   sequence and correctly situated match to Prosite entry
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK3"
FT                   /protein_id="CAC01356.1"
FT                   /translation="MTPRRRIRRAALLGAVCALAVTGAGLTGCSSEDPDAGTNGLGKLS
FT                   ADKIQAKAGTAAQAARTVRLHGSVEAAGSTYTLDMRLKADGGTGSVAAEGTTFGLLRVG
FT                   EQLFLKADAGFWSHDGGDAKAADKLAGKYVKVPQSDPVYKKFSGFTDKDVLLGGLLTLH
FT                   GTVKTDGRHEQAGVRTIRITGDDGAGGSLDVSLEGTPYPLRLVRAGSAGTIGFSDWNKD
FT                   FALEQPAKDDTLDYGKQLPSS"
     MTPRRRIRRA ALLGAVCALA VTGAGLTGCS SEDPDAGTNG LGKLSADKIQ AKAGTAAQAA        60
     RTVRLHGSVE AAGSTYTLDM RLKADGGTGS VAAEGTTFGL LRVGEQLFLK ADAGFWSHDG       120
     GDAKAADKLA GKYVKVPQSD PVYKKFSGFT DKDVLLGGLL TLHGTVKTDG RHEQAGVRTI       180
     RITGDDGAGG SLDVSLEGTP YPLRLVRAGS AGTIGFSDWN KDFALEQPAK DDTLDYGKQL       240
     PSS                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page