(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5156

AL939122.SCO5156     Location/Qualifiers
FT   CDS             complement(233185..233697)
FT                   /transl_table=11
FT                   /gene="SCO5156"
FT                   /gene_synonym="SCP8.19c"
FT                   /product="hypothetical protein SCP8.19c"
FT                   /note="SCP8.19c, unknown, len: 170 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBK2"
FT                   /protein_id="CAC01357.1"
FT                   /translation="MTSELLDQALVEEATKKSGLVWVKGPGVPARALWHVWHDGAACVV
FT                   GDGPGEQPLPGLADGAAAEVTVRSKDKGGRLVSWAARVVELPSGSEAWQAAVGDLKGKR
FT                   LNAPDGEAMTGRWARECRVLRLEPTGTTAPLPDASLAEAPLPSPATTRQPVPAGLPRLL
FT                   LKRRKRR"
     MTSELLDQAL VEEATKKSGL VWVKGPGVPA RALWHVWHDG AACVVGDGPG EQPLPGLADG        60
     AAAEVTVRSK DKGGRLVSWA ARVVELPSGS EAWQAAVGDL KGKRLNAPDG EAMTGRWARE       120
     CRVLRLEPTG TTAPLPDASL AEAPLPSPAT TRQPVPAGLP RLLLKRRKRR                  170
//

If you have problems or comments...

PBIL Back to PBIL home page