(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5161

AL939122.SCO5161     Location/Qualifiers
FT   CDS             238309..239166
FT                   /transl_table=11
FT                   /gene="SCO5161"
FT                   /gene_synonym="SCP8.24"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCP8.24, hypothetical protein, len: 285 aa; similar
FT                   to SW:TRPH_ECOLI (EMBL:AE000224) Escherichia coli TrpH
FT                   protein, 293 aa; fasta scores: opt: 376 z-score: 429.3 E():
FT                   1.9e-16; 30.6% identity in 248 aa overlap. Contains Pfam
FT                   match to entry PF02231 PHP_N, PHP domain N-terminal region"
FT                   /db_xref="GOA:Q9FBJ7"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ7"
FT                   /protein_id="CAC01362.1"
FT                   /translation="MRIDLHTHSTASDGTDTPAQLVRKAAATGLDVVALTDHDTTRGHA
FT                   EAVAALPEGLTLVTGAELSCRLDGVSMHMLAYLFDPEEPALLAERELVRDDRVPRARAM
FT                   VAKLNELGVPVTWEQVARIAGGGSVGRPHVASALVELGVVPTVNDAFTRDWLADGGRAH
FT                   VGKHETDPFEALRLIKGAGGVAVFAHPAAAKRGRTVSEAAIADLAAAGLDGIEVDHMDH
FT                   DTQTRARLRGAAKELGLLVTGSSDYHGSRKTCVLGEYTTDPEVYGEITRRAFGAFPVPG
FT                   AGGA"
     MRIDLHTHST ASDGTDTPAQ LVRKAAATGL DVVALTDHDT TRGHAEAVAA LPEGLTLVTG        60
     AELSCRLDGV SMHMLAYLFD PEEPALLAER ELVRDDRVPR ARAMVAKLNE LGVPVTWEQV       120
     ARIAGGGSVG RPHVASALVE LGVVPTVNDA FTRDWLADGG RAHVGKHETD PFEALRLIKG       180
     AGGVAVFAHP AAAKRGRTVS EAAIADLAAA GLDGIEVDHM DHDTQTRARL RGAAKELGLL       240
     VTGSSDYHGS RKTCVLGEYT TDPEVYGEIT RRAFGAFPVP GAGGA                       285
//

If you have problems or comments...

PBIL Back to PBIL home page