(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5162

AL939122.SCO5162     Location/Qualifiers
FT   CDS             239220..239825
FT                   /transl_table=11
FT                   /gene="SCO5162"
FT                   /gene_synonym="SCP8.25"
FT                   /product="putative integral membrane protein"
FT                   /note="SCP8.25, possible integral membrane protein, len:
FT                   201 aa; similar to SW:YCHE_ECOLI (EMBL:AE000222)
FT                   Escherichia coli hypothetical 23.5 kD protein in AdhE-OppA
FT                   intergenic region YchE, 215 aa; fasta scores: opt: 406
FT                   z-score: 496.2 E(): 3.6e-20; 30.0% identity in 207 aa
FT                   overlap. Contains Pfam match to entry PF01914 UPF0056,
FT                   Uncharacterized protein family UPF0056 and possible
FT                   hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9FBJ6"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ6"
FT                   /protein_id="CAC01363.1"
FT                   /translation="MFDVAVFGSLFLTLFVIMDPPGITPIFLALTSGRPGKVQKRMALQ
FT                   AVCVAGGVITVFGLLGHQILDYLHVSVPALMIAGGLLLLLIALDLLTGKTDEPKQTKDV
FT                   NVALVPLGMPLLAGPGAIVSVILAVQKADSVTTQVSVWAAILAIHVVLWLVMRYSLLII
FT                   RVIKDGGVVLVTRLAGMMLSAIAVQQIINGVTQVIQGA"
     MFDVAVFGSL FLTLFVIMDP PGITPIFLAL TSGRPGKVQK RMALQAVCVA GGVITVFGLL        60
     GHQILDYLHV SVPALMIAGG LLLLLIALDL LTGKTDEPKQ TKDVNVALVP LGMPLLAGPG       120
     AIVSVILAVQ KADSVTTQVS VWAAILAIHV VLWLVMRYSL LIIRVIKDGG VVLVTRLAGM       180
     MLSAIAVQQI INGVTQVIQG A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page