(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5163

AL939122.SCO5163     Location/Qualifiers
FT   CDS             complement(239892..240044)
FT                   /transl_table=11
FT                   /gene="SCO5163"
FT                   /gene_synonym="SCP8.26c"
FT                   /product="hypothetical protein SCP8.26c"
FT                   /note="SCP8.26c, unknown, len: 50 aa. Highly hydrophilic"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ5"
FT                   /protein_id="CAC01364.1"
FT                   /translation="MRFEVMRLDDVDGTPVDTTVVDAASVNRIVQQAAAIGQRLWIRPA
FT                   DTSAL"
     MRFEVMRLDD VDGTPVDTTV VDAASVNRIV QQAAAIGQRL WIRPADTSAL                   50
//

If you have problems or comments...

PBIL Back to PBIL home page