(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5166

AL939122.SCO5166     Location/Qualifiers
FT   CDS             complement(242300..244939)
FT                   /transl_table=11
FT                   /gene="SCO5166"
FT                   /gene_synonym="SCP8.29c"
FT                   /product="putative helicase"
FT                   /note="SCP8.29c, possible helicase, len: 879 aa; N-terminal
FT                   domain similar to SW:RHLE_ECOLI (EMBL:L02123) Escherichia
FT                   coli putative ATP-dependent RNA helicase RhlE, 454 aa;
FT                   fasta scores: opt: 884 z-score: 704.8 E(): 8.6e-32; 37.2%
FT                   identity in 444 aa overlap. Contains Pfam matches to
FT                   entries PF00270 DEAD, DEAD/DEAH box helicase and PF00271
FT                   helicase_C, Helicases conserved C-terminal domain and
FT                   matches to Prosite entries PS00017 ATP/GTP-binding site
FT                   motif A (P-loop) and PS00039 DEAD-box subfamily
FT                   ATP-dependent helicases signature. Also contains three sets
FT                   of different repeats: 10x RU1: RRTRK, 4x RU2:AAAKAEAAA and
FT                   4x RU3:AAEPA"
FT                   /db_xref="GOA:Q9FBJ2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ2"
FT                   /protein_id="CAC01367.1"
FT                   /translation="MTLPVALSGKDVIGQAKTGTGKTLGFGLPLLERVTVPADVEAGRA
FT                   APESLTDAPQALVVVPTRELCQQVTNDLLTAGKVRNVRVLAIYGGRAYEPQVEALKQGV
FT                   DVIVGTPGRLLDLAGQNKLSLKHIKSLVLDEADEMLDLGFLPDVEKIINMLPARRQTML
FT                   FSATMPGAVIGLARRYMSQPTHISATSPDDEGATVANTKQFIYRAHNMDKPEMVARILQ
FT                   ADGRGLAMVFCRTKRTAADLADQLKQRGFASGAVHGDLGQGAREQALRAFRNGKVDVLV
FT                   CTDVAARGIDVEGVTHVINYQSPEEEKTYLHRIGRTGRAGAKGTAITLVDWDDIPRWQL
FT                   INKALDLGFNDPPETYSTSPHLYTDLGIAEGTKGVLPRSERTRAGLDAEELEDLGEPGG
FT                   RGGRGRGDRGDRGGRGGRDDSRSGDRERDRSSRTTPRRRRRMRGGAPVDAEASVAPAAE
FT                   TVTVTDGAAGATDAGTDTDKAPRTLRRRRRTRSGEPSRRQETAATLGTDGPAAQAAEDA
FT                   ALAPSEAPVVETVAAEPVAAPEAVEAPAKPRRRTRTRKAAETPAAPLETAPTAAPTATE
FT                   ESIVAPAVVETPTVEAPAEKPRRRTRKATAAEATVETAEGAAEPAPEPAETKPRRRTRK
FT                   AAEPAAQAPDAEAEAEAKPRRTRKTTATKTAAAKAEAAADTAEAAEAKPKARRTRKAAE
FT                   PAVQAAPEGEAEAEAKPRRTRKTTATKTAAAKAEAAADTAEAAEAKPKARRTRKAAEPA
FT                   VQAAPEGEAETEAKPRRTRKTTATKTAAAKAEAAAKAEAAADTAEAAEAKPKARRARKT
FT                   AAAVEATAEIPAQASQEPEAAPRRRTRKAAVAVEAPAAGADTAEAKPKARRTRKTAAAA
FT                   QPAEAGES"
     MTLPVALSGK DVIGQAKTGT GKTLGFGLPL LERVTVPADV EAGRAAPESL TDAPQALVVV        60
     PTRELCQQVT NDLLTAGKVR NVRVLAIYGG RAYEPQVEAL KQGVDVIVGT PGRLLDLAGQ       120
     NKLSLKHIKS LVLDEADEML DLGFLPDVEK IINMLPARRQ TMLFSATMPG AVIGLARRYM       180
     SQPTHISATS PDDEGATVAN TKQFIYRAHN MDKPEMVARI LQADGRGLAM VFCRTKRTAA       240
     DLADQLKQRG FASGAVHGDL GQGAREQALR AFRNGKVDVL VCTDVAARGI DVEGVTHVIN       300
     YQSPEEEKTY LHRIGRTGRA GAKGTAITLV DWDDIPRWQL INKALDLGFN DPPETYSTSP       360
     HLYTDLGIAE GTKGVLPRSE RTRAGLDAEE LEDLGEPGGR GGRGRGDRGD RGGRGGRDDS       420
     RSGDRERDRS SRTTPRRRRR MRGGAPVDAE ASVAPAAETV TVTDGAAGAT DAGTDTDKAP       480
     RTLRRRRRTR SGEPSRRQET AATLGTDGPA AQAAEDAALA PSEAPVVETV AAEPVAAPEA       540
     VEAPAKPRRR TRTRKAAETP AAPLETAPTA APTATEESIV APAVVETPTV EAPAEKPRRR       600
     TRKATAAEAT VETAEGAAEP APEPAETKPR RRTRKAAEPA AQAPDAEAEA EAKPRRTRKT       660
     TATKTAAAKA EAAADTAEAA EAKPKARRTR KAAEPAVQAA PEGEAEAEAK PRRTRKTTAT       720
     KTAAAKAEAA ADTAEAAEAK PKARRTRKAA EPAVQAAPEG EAETEAKPRR TRKTTATKTA       780
     AAKAEAAAKA EAAADTAEAA EAKPKARRAR KTAAAVEATA EIPAQASQEP EAAPRRRTRK       840
     AAVAVEAPAA GADTAEAKPK ARRTRKTAAA AQPAEAGES                              879
//

If you have problems or comments...

PBIL Back to PBIL home page