(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5168

AL939122.SCO5168     Location/Qualifiers
FT   CDS             complement(246330..246599)
FT                   /transl_table=11
FT                   /gene="SCO5168"
FT                   /gene_synonym="SCP8.31c"
FT                   /product="putative integral membrane protein"
FT                   /note="SCP8.31c, possible integral membrane protein, len:
FT                   89 aa. Contains possible hydrophobic membrane spanning
FT                   regions. Also high content in alanine and leucine amino
FT                   acid residues"
FT                   /db_xref="GOA:Q9FBJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBJ0"
FT                   /protein_id="CAC01369.1"
FT                   /translation="MFLEALSAALLGLALAWAAAHRLPHRLPAPLLVLPTGVAGALFGA
FT                   FVTHTALGAGGLVPVLLGSATVSAASLSLLLRPAGRLRRSSATA"
     MFLEALSAAL LGLALAWAAA HRLPHRLPAP LLVLPTGVAG ALFGAFVTHT ALGAGGLVPV        60
     LLGSATVSAA SLSLLLRPAG RLRRSSATA                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page