(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5170

AL939122.SCO5170     Location/Qualifiers
FT   CDS             complement(247213..247854)
FT                   /transl_table=11
FT                   /gene="SCO5170"
FT                   /gene_synonym="SCP8.33c"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="SCP8.33c, probable tetR-family transcriptional
FT                   regulator, len: 213 aa; similar to TR:O53661
FT                   (EMBL:AL021929) Mycobacterium tuberculosis putative
FT                   regulatory protein MTV034.04, 204 aa; fasta scores: opt:
FT                   309 z-score: 383.4 E(): 6.9e-14; 31.3% identity in 201 aa
FT                   overlap. Contains Pfam match to entry PF00440 tetR,
FT                   Bacterial regulatory proteins, tetR family and possible
FT                   helix-turn-helix motif at residues 42..63 (+3.37 SD)"
FT                   /db_xref="GOA:Q9FBI8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI8"
FT                   /protein_id="CAC01371.1"
FT                   /translation="MTAIEQTEAVRPRGTRLPRRARRNQLLGAAQEVFVAQGYHAAAMD
FT                   DIAERAGVSKPVLYQHFPGKLDLYLALLDQHCEALIQSVRSALASTSDNKQRVRATMDA
FT                   YFAYVEDDGGAFRLVFESDLTNEPAVRERVDKVTNECAEAICDVIAEDTGLSRAESMLL
FT                   ASGLGGLAQVVARSWLHSDRSVPRDQAVQLLTSLAWRGIAGFPLHGIEQH"
     MTAIEQTEAV RPRGTRLPRR ARRNQLLGAA QEVFVAQGYH AAAMDDIAER AGVSKPVLYQ        60
     HFPGKLDLYL ALLDQHCEAL IQSVRSALAS TSDNKQRVRA TMDAYFAYVE DDGGAFRLVF       120
     ESDLTNEPAV RERVDKVTNE CAEAICDVIA EDTGLSRAES MLLASGLGGL AQVVARSWLH       180
     SDRSVPRDQA VQLLTSLAWR GIAGFPLHGI EQH                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page