(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5173

AL939122.SCO5173     Location/Qualifiers
FT   CDS             249569..251248
FT                   /transl_table=11
FT                   /gene="SCO5173"
FT                   /gene_synonym="SCP8.36"
FT                   /product="conserved hypothetical protein"
FT                   /note="SCP8.36, hypothetical protein, len: 559 aa; low
FT                   similarity to TR:Q9XAG2 (EMBL:AL079356) Streptomyces
FT                   coelicolor possible membrane protein SC6G9.20, 303 aa;
FT                   fasta scores: opt: 452 z-score: 362.9 E(): 9.5e-13; 34.1%
FT                   identity in 258 aa overlap"
FT                   /db_xref="InterPro:IPR022603"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI6"
FT                   /protein_id="CAC01374.1"
FT                   /translation="MGRHSRRGPAPKADAADTAAARENRAGRPDPRRTNGPSQEPQGPY
FT                   QPQGPHQSQRPHQPQGVEGAAPPGAAPGDVPGARQGYAGPSPGRGPGARLPDGETSAHG
FT                   FPRTADGTPAGGVPGYPDGTPAHGVPRYPDGTPAHGVPRFSDGTPAHGVPRVRGGHPEQ
FT                   REPGGGWGEPAGRPGAGYGSVSGPRNGAPESFAPPSPSGPASAFPRQRQAPAEGPRQDY
FT                   LDAFRADDDVFAVRPRGRIPGAARPADPYASVTDWSAEDGGASGGGGIPGGAEADADDE
FT                   PPTGEPAPAKGAKGRTFTGIAAAAVTTVLAVVVAGQVADGSDGSDMRAQSATDQARGAH
FT                   DPASRDDERPTPAASASAKPLTYEQKMGRTYPLGATLKASGKFDAVPGIAKGTGKGQKY
FT                   TYRIDVEQGLGLDGGLFAEAVQKTLNDDRSWAHNGARTFERVESGQPDFVITLASPGTT
FT                   AEWCAKSGLDTTEDNVSCDSAATQRVMINAYRWAQGAAPYGDAIHAYRQMLINHEVGHR
FT                   IGYNHVTCDKDGELAPVMQQQTKFVDHDGIDCRPNAWAYPNG"
     MGRHSRRGPA PKADAADTAA ARENRAGRPD PRRTNGPSQE PQGPYQPQGP HQSQRPHQPQ        60
     GVEGAAPPGA APGDVPGARQ GYAGPSPGRG PGARLPDGET SAHGFPRTAD GTPAGGVPGY       120
     PDGTPAHGVP RYPDGTPAHG VPRFSDGTPA HGVPRVRGGH PEQREPGGGW GEPAGRPGAG       180
     YGSVSGPRNG APESFAPPSP SGPASAFPRQ RQAPAEGPRQ DYLDAFRADD DVFAVRPRGR       240
     IPGAARPADP YASVTDWSAE DGGASGGGGI PGGAEADADD EPPTGEPAPA KGAKGRTFTG       300
     IAAAAVTTVL AVVVAGQVAD GSDGSDMRAQ SATDQARGAH DPASRDDERP TPAASASAKP       360
     LTYEQKMGRT YPLGATLKAS GKFDAVPGIA KGTGKGQKYT YRIDVEQGLG LDGGLFAEAV       420
     QKTLNDDRSW AHNGARTFER VESGQPDFVI TLASPGTTAE WCAKSGLDTT EDNVSCDSAA       480
     TQRVMINAYR WAQGAAPYGD AIHAYRQMLI NHEVGHRIGY NHVTCDKDGE LAPVMQQQTK       540
     FVDHDGIDCR PNAWAYPNG                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page