(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5174

AL939122.SCO5174     Location/Qualifiers
FT   CDS             251463..253244
FT                   /transl_table=11
FT                   /gene="SCO5174"
FT                   /gene_synonym="SCP8.37"
FT                   /product="putative transferase"
FT                   /note="SCP8.37, possible transferase, len: 593 aa;
FT                   C-terminal region similar to TR:CAB92272 (EMBL:AL356595)
FT                   Streptomyces coelicolor putative transferase SCC61A.27, 436
FT                   aa; fasta scores: opt: 233 z-score: 251.3 E(): 1.6e-06;
FT                   29.9% identity in 462 aa overlap. Contains Pfam match to
FT                   entry PF00534 Glycos_transf_1, Glycosyl transferases group
FT                   1. Also contains 3x conserved repeat unit: ARSSE"
FT                   /db_xref="GOA:Q9FBI5"
FT                   /db_xref="InterPro:IPR022622"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI5"
FT                   /protein_id="CAC01375.1"
FT                   /translation="MRIGLLTEGGYPYVSGEAGLWCDRLVRGLEHHEFDVYALSRSERE
FT                   EDGGWVPLPPQVGRVRTAPLWETVDDGIVHGRRARRRFAECYGELATALCAAAPGDPAR
FT                   SSEARSSEARSSEGEPEGQSALEADRFASALYGLAELARDEGGLPTALRSETAVRALER
FT                   ACRAPGAHRSAREARVPDLLAVAARLERALRPLSLDWYEDDDLGSVDLCHAASGGTGAL
FT                   PGLLARHFCDVPLLVTEYGVRLRTHYLTEPDSSPAIRSLLAAFHGRLAAETYRRAAVIT
FT                   PGNTHTRRWQERCGADRAKLRTVHPGMDAAPFAEAGESPECADPQTLVWVGRVEPAKDL
FT                   VSLLHAFAEVRRAEPGSRLRIVGAPFGPEGVAYLAHCKGLAAQLFPDEADGPHAVGRNP
FT                   VSFEETGGPELPSRADAYASGALVVLSSVVEGFPTGLVEAMFCGRATVSTDVGAVVEAI
FT                   GGTGLVVPPRNPRALAEACVALLRDPERRERLGAAARARALELFTVEQNITAFHGIYLE
FT                   ILSRAPVRRVVLDGAGEPLPFGVPAEAHVPGRWSDATARAAARGGPGAVRTGPGWATGG
FT                   GPVRATTAVSAAEGASR"
     MRIGLLTEGG YPYVSGEAGL WCDRLVRGLE HHEFDVYALS RSEREEDGGW VPLPPQVGRV        60
     RTAPLWETVD DGIVHGRRAR RRFAECYGEL ATALCAAAPG DPARSSEARS SEARSSEGEP       120
     EGQSALEADR FASALYGLAE LARDEGGLPT ALRSETAVRA LERACRAPGA HRSAREARVP       180
     DLLAVAARLE RALRPLSLDW YEDDDLGSVD LCHAASGGTG ALPGLLARHF CDVPLLVTEY       240
     GVRLRTHYLT EPDSSPAIRS LLAAFHGRLA AETYRRAAVI TPGNTHTRRW QERCGADRAK       300
     LRTVHPGMDA APFAEAGESP ECADPQTLVW VGRVEPAKDL VSLLHAFAEV RRAEPGSRLR       360
     IVGAPFGPEG VAYLAHCKGL AAQLFPDEAD GPHAVGRNPV SFEETGGPEL PSRADAYASG       420
     ALVVLSSVVE GFPTGLVEAM FCGRATVSTD VGAVVEAIGG TGLVVPPRNP RALAEACVAL       480
     LRDPERRERL GAAARARALE LFTVEQNITA FHGIYLEILS RAPVRRVVLD GAGEPLPFGV       540
     PAEAHVPGRW SDATARAAAR GGPGAVRTGP GWATGGGPVR ATTAVSAAEG ASR              593
//

If you have problems or comments...

PBIL Back to PBIL home page