(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5175

AL939122.SCO5175     Location/Qualifiers
FT   CDS             253391..254458
FT                   /transl_table=11
FT                   /gene="SCO5175"
FT                   /gene_synonym="SCP8.38"
FT                   /product="putative integral membrane protein"
FT                   /note="SCP8.38, possible integral membrane protein, len:
FT                   355 aa; similar to TR:Q9RWF6 (EMBL:AE001927) Deinococcus
FT                   radiodurans hypothetical 51.5 kD protein DR0712, 494 aa;
FT                   fasta scores: opt: 182 z-score: 183.8 E(): 0.009; 30.3%
FT                   identity in 429 aa overlap"
FT                   /db_xref="GOA:Q9FBI4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI4"
FT                   /protein_id="CAC01376.1"
FT                   /translation="MKGLLHRHRELCERAVDPLEIVAGLEAHGVTDRTAARFRHRDVFS
FT                   LAEEMYARVPRDGDAPAPPEDGPTPRPGGPRAAGSVLLALLPGVLCAAAVAGLRLTDGR
FT                   PRLIAAAVGVLAVSLALGAALRRGPLTAATRTTSTWTCWLLGYALLGDGLLRTAVSGGP
FT                   DGLPDGSPDGAWPVTLAPVLALTLSYAPAAGCAHLFAAGARRKLSSSRGLTDFSASVRP
FT                   LLLGAFALYLGALAALLTLTGAVLGEPADWSQGLSLGALLLLARLLGVHGHTHAGPFVL
FT                   TATAAAEAAALATVFAGRLPGCGLLSAPVEALVAACGPAGVPTAACGIGALALLVHACR
FT                   RLTRASAHASTERTR"
     MKGLLHRHRE LCERAVDPLE IVAGLEAHGV TDRTAARFRH RDVFSLAEEM YARVPRDGDA        60
     PAPPEDGPTP RPGGPRAAGS VLLALLPGVL CAAAVAGLRL TDGRPRLIAA AVGVLAVSLA       120
     LGAALRRGPL TAATRTTSTW TCWLLGYALL GDGLLRTAVS GGPDGLPDGS PDGAWPVTLA       180
     PVLALTLSYA PAAGCAHLFA AGARRKLSSS RGLTDFSASV RPLLLGAFAL YLGALAALLT       240
     LTGAVLGEPA DWSQGLSLGA LLLLARLLGV HGHTHAGPFV LTATAAAEAA ALATVFAGRL       300
     PGCGLLSAPV EALVAACGPA GVPTAACGIG ALALLVHACR RLTRASAHAS TERTR            355
//

If you have problems or comments...

PBIL Back to PBIL home page