(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5176

AL939122.SCO5176     Location/Qualifiers
FT   CDS             254510..255622
FT                   /transl_table=11
FT                   /gene="SCO5176"
FT                   /gene_synonym="SCP8.39"
FT                   /product="putative reductase"
FT                   /note="SCP8.39, probable reductase, len: 370 aa; similar to
FT                   TR:O54256 (EMBL:AJ224512) Streptomyces nogalater putative
FT                   dTDP-4-keto-6-deoxyhexose reductase SnoG, 328 aa; fasta
FT                   scores: opt: 316 z-score: 337.4 E(): 2.5e-11; 30.5%
FT                   identity in 364 aa overlap"
FT                   /db_xref="GOA:Q9FBI3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FBI3"
FT                   /protein_id="CAC01377.1"
FT                   /translation="MKEPPDDHLPTRRLGTGSRPMRVLLIGANGYIGRFVADRLLADPA
FT                   VQLTALGRGDDADVRFDLATGSPGALTRFLDAVHPGVVVNCAGATRGGARELTRHNTVA
FT                   VATVCEALRRSGCGARLVQVGCSAEYGPSQPGSSTAEDAVPRPGGPYGVSKLAATELVL
FT                   GSGLDAVVLRVFSPAGPGTPAGSPLGRLAEAMRRAMQSGDGELRLGGLGAQRDFVDVRD
FT                   VARAVHAASLSAAQGVINIGSGRAVRLRDAAATLARVAGYGGALHELDGPPGALRPTIG
FT                   HPRTESLGHRVDALGHHRSDALGHHRPDPLQSRGERTDPEHTTPAPYPDGCGSWQQADV
FT                   RTARDRLGWRPRIALEESLADIWMEAACRI"
     MKEPPDDHLP TRRLGTGSRP MRVLLIGANG YIGRFVADRL LADPAVQLTA LGRGDDADVR        60
     FDLATGSPGA LTRFLDAVHP GVVVNCAGAT RGGARELTRH NTVAVATVCE ALRRSGCGAR       120
     LVQVGCSAEY GPSQPGSSTA EDAVPRPGGP YGVSKLAATE LVLGSGLDAV VLRVFSPAGP       180
     GTPAGSPLGR LAEAMRRAMQ SGDGELRLGG LGAQRDFVDV RDVARAVHAA SLSAAQGVIN       240
     IGSGRAVRLR DAAATLARVA GYGGALHELD GPPGALRPTI GHPRTESLGH RVDALGHHRS       300
     DALGHHRPDP LQSRGERTDP EHTTPAPYPD GCGSWQQADV RTARDRLGWR PRIALEESLA       360
     DIWMEAACRI                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page