(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5177

AL939122.SCO5177     Location/Qualifiers
FT   CDS             255610..256359
FT                   /transl_table=11
FT                   /gene="SCO5177"
FT                   /gene_synonym="2SC3B6.01"
FT                   /product="hypothetical protein 2SC3B6.01"
FT                   /note="2SC3B6.01, unknown, len: 249 aa"
FT                   /db_xref="InterPro:IPR021986"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCL1"
FT                   /protein_id="CAC01307.1"
FT                   /translation="MSYLTSTKAGVASTGVHTGLGVPGLAHPLLAPDEWAGLTCPGTPL
FT                   HWVVLNIADGPGAHPDPRCLEAAGRLRNAGIRVLGHLDTAYGARSLGEQISDARRYLDW
FT                   YQVDGFLLAHCPSDRAALPEVRRTVTTLRAIRDDAHIVLGHGTHPCPGYAENADQLVTF
FT                   SGTWADYRWSQAAEWSADYPPERFCHFVHGLPRGHLEEALRIARWQGAATICFTDRTDH
FT                   GGRADPWETMPGYWDEIVSRVGTGVSE"
     MSYLTSTKAG VASTGVHTGL GVPGLAHPLL APDEWAGLTC PGTPLHWVVL NIADGPGAHP        60
     DPRCLEAAGR LRNAGIRVLG HLDTAYGARS LGEQISDARR YLDWYQVDGF LLAHCPSDRA       120
     ALPEVRRTVT TLRAIRDDAH IVLGHGTHPC PGYAENADQL VTFSGTWADY RWSQAAEWSA       180
     DYPPERFCHF VHGLPRGHLE EALRIARWQG AATICFTDRT DHGGRADPWE TMPGYWDEIV       240
     SRVGTGVSE                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page