(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5182

AL939122.SCO5182     Location/Qualifiers
FT   CDS             263823..264374
FT                   /transl_table=11
FT                   /gene="SCO5182"
FT                   /gene_synonym="2SC3B6.06"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.06, conserved hypothetical protein, len: 183
FT                   aa; similar to TR:Q9RX87 (EMBL:AE001902) Deinococcus
FT                   radiodurans conserved hypothetical protein DR0428, 139 aa;
FT                   fasta scores: opt: 187 z-score: 230.6 E(): 2.2e-05; 35.2%
FT                   identity in 122 aa overlap"
FT                   /db_xref="GOA:Q9FCK6"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK6"
FT                   /protein_id="CAC01312.1"
FT                   /translation="MVACRVRLGRHQGARAGRTVCPKHRLRARDAGSRECAALSAGCGR
FT                   MGRMSEQSLPDGVRPQNADALPEYAERVLDMTELIPPGRVMTYGDVAEYLEEGGPRQVG
FT                   RVMSLYGGGVPWWRVVRADGVLLAGHELEALDRYREEGTPLKEASRAAEGHLPRLDLKR
FT                   ARWDGEGRPQGHGGRAQGHT"
     MVACRVRLGR HQGARAGRTV CPKHRLRARD AGSRECAALS AGCGRMGRMS EQSLPDGVRP        60
     QNADALPEYA ERVLDMTELI PPGRVMTYGD VAEYLEEGGP RQVGRVMSLY GGGVPWWRVV       120
     RADGVLLAGH ELEALDRYRE EGTPLKEASR AAEGHLPRLD LKRARWDGEG RPQGHGGRAQ       180
     GHT                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page