(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5184

AL939122.SCO5184     Location/Qualifiers
FT   CDS             268145..271813
FT                   /transl_table=11
FT                   /gene="SCO5184"
FT                   /gene_synonym="2SC3B6.08"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /note="2SC3B6.08, possible ATP-dependent DNA helicase, len:
FT                   1222 aa; similar to TR::O53347 (EMBL:AL021646)
FT                   Mycobacterium tuberculosis putative ATP-dependent DNA
FT                   helicase, MTV014.45c, 1101 aa; fasta scores: opt: 1209
FT                   z-score: 1062.9 E(): 0; 38.4% identity in 1199 aa overlap
FT                   to SW:HELD_ECOLI (EMBL:J04726) Escherichia coli helicase IV
FT                   (EC 3.6.1.-) HelD, 648 aa; fasta scores: opt: 216 z-score:
FT                   194.6 E(): 0.0023; 25.3% identity in 471 aa overlap and to
FT                   Streptomyces coelicolor 2SC3B6.07, 1159 aa; fasta scores:
FT                   opt: 406 z-score: 293.0 E(): 1e-10; 30.2% identity in 977
FT                   aa overlap. Contains Pfam match to entry PF00580
FT                   UvrD-helicase, UvrD/REP helicase and match to Prosite entry
FT                   PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="GOA:Q9FCK4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK4"
FT                   /protein_id="CAC01314.1"
FT                   /translation="MWPDRSRPGPPEPPRRAAGVTRRTTRADLHFPPTREDIRHQLSVA
FT                   AASLSDVPAHITDPEQLKELLGIPFTPEQTACIVAPPAPQVIVAGAGSGKTTVMAARVV
FT                   WLVGTGQVAPEQVLGLTFTNKAAGELAERVRTALIRAGVTDPDVIDPDHPPGEPAISTY
FT                   HAFAGRLLTDHGLRLGLEPTSRLLADATRYQLAARVLREAPGPYPALTRSFADLVSDLL
FT                   ALDGELAEHLVRPEDLRAWDAGLLDTLDGVRLSNADLRKVPEAAAARRELADLVIRYRA
FT                   AKRRQDLLDFGDQIALSAQLAGLPEVGRVLRDDYRVVLLDEYQDTSVAQRILLAGLFGG
FT                   GTGHPVTAVGDPCQAIYGWRGASVANLDDFPEHFAHADGRPAARQALSENRRSGGRLLD
FT                   LANGLAEPLRAMHAGVEALRPAPGAERDGMVRCALLSTHAEEIDWIADSVAHLVRTGKA
FT                   PGEIAVLCRTATDFAEIQGALVARDVPVEVVGLSGLLHLPEVADLVAVCEVLQDPGANA
FT                   SLVRLLSGPRWRVGPRDLALLGRRARLLVSHARVEGDDDPDRRLAEAVEGVDPSEVISL
FT                   ADALDTFLETPLDGTGDDDGLPFSADARVRFARLATELRELRRALSDPLMDVLHRVLAV
FT                   TGLEVELSASPHALAARRRETLSNFLDVAASFAAGDGEATLLAFLGFLRTAAQYEKGLD
FT                   NALPGGENTVKVLTAHKSKGLEWDVVAVPGLVTGTFPSGQGREKWTAQGKVLPHGLRGD
FT                   AETLPDVASWDARGLKAFHEAMKDHQHTEELRLGYVTFTRPRSLLLGSGHWWGPSQKKP
FT                   RGPSDFLTALYEHCAAGHGEIEVWADEPAEDEENPALHRATADEVWPLPLDDAALARRR
FT                   SAAETVLAHLDGLAAREDGPPSAPATYEDPDWPPPPEDDEGLPEEAEPDRAGDPAHWDS
FT                   WTTERPAAAREAATAPESPAAPQAGPTVPHQAPPPEQPPGTAPVPAPARLTPEEARTVA
FT                   SWDRDLDALTGELLRARESVTEVPLPASLTASQLLSLAADPDGFAQELARPMPRPPQPA
FT                   ARRGTRFHAWVEARFEPLTLPLLEPEELPGGDAEIADDHDLEFLKDAFERTEYARRTPF
FT                   RVEAPFQLSLAGRVVRGRIDAVYKEGDGDTATYEIVDWKTNRAATADPLQLALYRIAWA
FT                   EQQHVPPASVTAAFLYVRTGEVVRPEGLPDRAALEKLLLAEPVGDEPHDRGVRAGR"
     MWPDRSRPGP PEPPRRAAGV TRRTTRADLH FPPTREDIRH QLSVAAASLS DVPAHITDPE        60
     QLKELLGIPF TPEQTACIVA PPAPQVIVAG AGSGKTTVMA ARVVWLVGTG QVAPEQVLGL       120
     TFTNKAAGEL AERVRTALIR AGVTDPDVID PDHPPGEPAI STYHAFAGRL LTDHGLRLGL       180
     EPTSRLLADA TRYQLAARVL REAPGPYPAL TRSFADLVSD LLALDGELAE HLVRPEDLRA       240
     WDAGLLDTLD GVRLSNADLR KVPEAAAARR ELADLVIRYR AAKRRQDLLD FGDQIALSAQ       300
     LAGLPEVGRV LRDDYRVVLL DEYQDTSVAQ RILLAGLFGG GTGHPVTAVG DPCQAIYGWR       360
     GASVANLDDF PEHFAHADGR PAARQALSEN RRSGGRLLDL ANGLAEPLRA MHAGVEALRP       420
     APGAERDGMV RCALLSTHAE EIDWIADSVA HLVRTGKAPG EIAVLCRTAT DFAEIQGALV       480
     ARDVPVEVVG LSGLLHLPEV ADLVAVCEVL QDPGANASLV RLLSGPRWRV GPRDLALLGR       540
     RARLLVSHAR VEGDDDPDRR LAEAVEGVDP SEVISLADAL DTFLETPLDG TGDDDGLPFS       600
     ADARVRFARL ATELRELRRA LSDPLMDVLH RVLAVTGLEV ELSASPHALA ARRRETLSNF       660
     LDVAASFAAG DGEATLLAFL GFLRTAAQYE KGLDNALPGG ENTVKVLTAH KSKGLEWDVV       720
     AVPGLVTGTF PSGQGREKWT AQGKVLPHGL RGDAETLPDV ASWDARGLKA FHEAMKDHQH       780
     TEELRLGYVT FTRPRSLLLG SGHWWGPSQK KPRGPSDFLT ALYEHCAAGH GEIEVWADEP       840
     AEDEENPALH RATADEVWPL PLDDAALARR RSAAETVLAH LDGLAAREDG PPSAPATYED       900
     PDWPPPPEDD EGLPEEAEPD RAGDPAHWDS WTTERPAAAR EAATAPESPA APQAGPTVPH       960
     QAPPPEQPPG TAPVPAPARL TPEEARTVAS WDRDLDALTG ELLRARESVT EVPLPASLTA      1020
     SQLLSLAADP DGFAQELARP MPRPPQPAAR RGTRFHAWVE ARFEPLTLPL LEPEELPGGD      1080
     AEIADDHDLE FLKDAFERTE YARRTPFRVE APFQLSLAGR VVRGRIDAVY KEGDGDTATY      1140
     EIVDWKTNRA ATADPLQLAL YRIAWAEQQH VPPASVTAAF LYVRTGEVVR PEGLPDRAAL      1200
     EKLLLAEPVG DEPHDRGVRA GR                                               1222
//

If you have problems or comments...

PBIL Back to PBIL home page