(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5186

AL939122.SCO5186     Location/Qualifiers
FT   CDS             273386..274342
FT                   /transl_table=11
FT                   /gene="SCO5186"
FT                   /gene_synonym="2SC3B6.10"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.10, conserved hypothetical protein, len: 318
FT                   aa; similar to TR:O53345 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis hypothetical 33.8 kD protein MTV014.43c, 313
FT                   aa; fasta scores: opt: 334 z-score: 389.2 E(): 3.3e-14;
FT                   33.3% identity in 318 aa overlap"
FT                   /db_xref="GOA:Q9FCK2"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK2"
FT                   /protein_id="CAC01316.1"
FT                   /translation="MEAPVTTWTDHTADRPISLTAPSGVDRAAHHRLDEAWLAAAWSHP
FT                   STRCFVVSGGQVLIDETPDGATELVMTPSFEAPLTEAHRYFLGTDEDGTSYFALQKDSL
FT                   PGRMDQSARPAGLREAGLLLSPRDAGLMAHAVALENWQRLHRFCSRCGERTVIAAAGHI
FT                   RRCPACGAEHYPRTDPAVIMAVTDGEDRILLGRQVHWARGPLLDPRRFRGARRVHRAVG
FT                   APRGPGGGRRHRRPGRVRREPAVAFPSSLMLGFMAHATSTEIDVDGDEIHEARWFSREE
FT                   LGAAFESGEVLPPYGISIAARLIELWYGRPLPTRSAF"
     MEAPVTTWTD HTADRPISLT APSGVDRAAH HRLDEAWLAA AWSHPSTRCF VVSGGQVLID        60
     ETPDGATELV MTPSFEAPLT EAHRYFLGTD EDGTSYFALQ KDSLPGRMDQ SARPAGLREA       120
     GLLLSPRDAG LMAHAVALEN WQRLHRFCSR CGERTVIAAA GHIRRCPACG AEHYPRTDPA       180
     VIMAVTDGED RILLGRQVHW ARGPLLDPRR FRGARRVHRA VGAPRGPGGG RRHRRPGRVR       240
     REPAVAFPSS LMLGFMAHAT STEIDVDGDE IHEARWFSRE ELGAAFESGE VLPPYGISIA       300
     ARLIELWYGR PLPTRSAF                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page