(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5187

AL939122.SCO5187     Location/Qualifiers
FT   CDS             complement(274429..274671)
FT                   /transl_table=11
FT                   /gene="SCO5187"
FT                   /gene_synonym="2SC3B6.11c"
FT                   /product="putative glutaredoxin-like protein"
FT                   /note="2SC3B6.11c, possible glutaredoxin-like protein, len:
FT                   80 aa; similar to SW:NRDH_LACLC (EMBL:X92690) Lactococcus
FT                   lactis glutaredoxin-like protein NrdH, 72 aa; fasta scores:
FT                   opt: 119 z-score: 176.0 E(): 0.024; 35.6% identity in 59 aa
FT                   overlap. Contains match to Prosite entry PS00194
FT                   Thioredoxin family active site"
FT                   /db_xref="GOA:Q9FCK1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011915"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCK1"
FT                   /protein_id="CAC01317.1"
FT                   /translation="MSGTVTMYSTTWCGYCRRLKSQMDREGIAYTEVNIEQDPESAAFV
FT                   EKANGGNQTVPTVLFPDGSTLTNPSLAQVKQKIGA"
     MSGTVTMYST TWCGYCRRLK SQMDREGIAY TEVNIEQDPE SAAFVEKANG GNQTVPTVLF        60
     PDGSTLTNPS LAQVKQKIGA                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page