(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5190

AL939122.SCO5190     Location/Qualifiers
FT   CDS             277747..278115
FT                   /transl_table=11
FT                   /gene="SCO5190"
FT                   /gene_synonym="2SC3B6.14"
FT                   /product="putative DNA-binding protein"
FT                   /note="2SC3B6.14, possible DNA-binding protein, len: 122
FT                   aa; similar to TR:Q9X952 (EMBL:AJ239087) Streptomyces
FT                   coelicolor hypothetical 9.7 kD protein WblE, 85 aa; fasta
FT                   scores: opt: 183 z-score: 243.0 E(): 4.6e-06; 40.5%
FT                   identity in 74 aa overlap and to TR:Q9S426 (EMBL:AF164439)
FT                   Mycobacterium smegmatis WhmD, 129 aa; fasta scores: opt:
FT                   161 z-score: 213.2 E(): 0.00021; 29.0% identity in 93 aa
FT                   overlap. Contains Pfam match to entry PF02178 AT_hook, DNA
FT                   binding domain with preference for A/T rich regions and
FT                   match to Prosite entry PS00354 HMG-I and HMG-Y DNA-binding
FT                   domain (A+T-hook)"
FT                   /db_xref="GOA:Q9FCJ8"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ8"
FT                   /protein_id="CAC01320.1"
FT                   /translation="MQLEAHAPSVPPSDTIPKPCSTEDSTLTPLTALTALDDAIENLGV
FT                   PVPCRSYDPEVFFAESPADVEYAKSLCRTCPLIEACLAGAKERREPWGVWGGELFVQGV
FT                   VVARKRPRGRPRKNPVSA"
     MQLEAHAPSV PPSDTIPKPC STEDSTLTPL TALTALDDAI ENLGVPVPCR SYDPEVFFAE        60
     SPADVEYAKS LCRTCPLIEA CLAGAKERRE PWGVWGGELF VQGVVVARKR PRGRPRKNPV       120
     SA                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page