(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5194

AL939122.SCO5194     Location/Qualifiers
FT   CDS             281506..282012
FT                   /transl_table=11
FT                   /gene="SCO5194"
FT                   /gene_synonym="2SC3B6.18"
FT                   /product="hypothetical protein"
FT                   /note="2SC3B6.18, hypothetical protein, len: 168 aa;
FT                   similar to TR:CAB72040 (EMBL:AJ391262) Neisseria
FT                   meningitidis hypothetical 26.6 kD protein RNI5, 230 aa;
FT                   fasta scores: opt: 249 z-score: 315.5 E(): 4.2e-10; 41.7%
FT                   identity in 103 aa overlap"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ4"
FT                   /protein_id="CAC01324.1"
FT                   /translation="MRRSARRRRTVSAYREGDRTVVLIPARMSEAEEQRWVSVMLDKLA
FT                   AQESKRVLGDAELAERAERLSGQYFEGRARPASVRWVTNQNTRWGSCTPSEGSIRLSHR
FT                   LQGMPEYVVDYVLLHELAHLLVPGHGPRFWRLLEAYPRTERARGYLEGVVAADRLPHVP
FT                   GARSE"
     MRRSARRRRT VSAYREGDRT VVLIPARMSE AEEQRWVSVM LDKLAAQESK RVLGDAELAE        60
     RAERLSGQYF EGRARPASVR WVTNQNTRWG SCTPSEGSIR LSHRLQGMPE YVVDYVLLHE       120
     LAHLLVPGHG PRFWRLLEAY PRTERARGYL EGVVAADRLP HVPGARSE                    168
//

If you have problems or comments...

PBIL Back to PBIL home page