(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5195

AL939122.SCO5195     Location/Qualifiers
FT   CDS             282152..283906
FT                   /transl_table=11
FT                   /gene="SCO5195"
FT                   /gene_synonym="2SC3B6.19"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.19, hypothetical protein, len: 584 aa;
FT                   N-terminal region similar to N-terminal region of TR:Q9RSA4
FT                   (EMBL:AE002055) Deinococcus radiodurans tellurium
FT                   resistance protein TerA DR2223, 400 aa; fasta scores: opt:
FT                   552 z-score: 357.3 E(): 1.9e-12; 40.6% identity in 239 aa
FT                   overlap and C-terminal region similar to TR:Q9RWP1
FT                   (EMBL:AE001920) Deinococcus radiodurans conserved
FT                   hypothetical protein DR0625, 254 aa; blastp scores: Score =
FT                   262 (92.2 bits), Expect = 7.4e-22, P = 7.4e-22, Identities
FT                   = 68/208 (32%), Positives = 117/208 (56%)"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ3"
FT                   /protein_id="CAC01325.1"
FT                   /translation="MAREFQRGHKARISDLTSGTDLYVGVQISGPGLNFDISCFGLDAD
FT                   ERLSDDRYFVFFNQPKTPEESIQLLGAQAGDTESFRVTLDRIPQQIQKLSFTATIDGAG
FT                   QMSQVGPGYIRIVAGGEEVARYPFSGSEFSTERAVMLGDFYLKDVWRFAAVGQGFDGGL
FT                   DALLKNFGGEVAEDEAPAPQQAPQPQAGAAPGFAPPAQAAAPPAFGAPAAPAPAAPAPA
FT                   PVPQPAPQGFAPPPAAPPPPAPVPAPGPDVHAAQTIVAPMNTPPGGAPVPPPAPAPAPY
FT                   GQPGQPGQQPPYGQVLGQTAPPPPGYGQPQAPQAPAPPPGYGQPTAPPGYGQQPGPPAA
FT                   YGQQAPPPGYGQQPPQAMPRGAPQGAGVTAALQQFRETPTGQRWTQQNKKLVRVDLGAE
FT                   GQPVLARQGSMVLYQGKVDFSYKGAGFAGRVVGNATGQEMQLMRCTGKGQVFLAENSAM
FT                   LHPIELQGDAVCVSAENVLAFDESLQYEVRRIEGHGIPGGALFTMQFQGTGTVVVKTRG
FT                   VPVVLPVTPTTFADCNAVVAWSAAAQVVVSSQVRMRRNSYAGDTGESVNLQFRAAPGSF
FT                   VVVQPYEI"
     MAREFQRGHK ARISDLTSGT DLYVGVQISG PGLNFDISCF GLDADERLSD DRYFVFFNQP        60
     KTPEESIQLL GAQAGDTESF RVTLDRIPQQ IQKLSFTATI DGAGQMSQVG PGYIRIVAGG       120
     EEVARYPFSG SEFSTERAVM LGDFYLKDVW RFAAVGQGFD GGLDALLKNF GGEVAEDEAP       180
     APQQAPQPQA GAAPGFAPPA QAAAPPAFGA PAAPAPAAPA PAPVPQPAPQ GFAPPPAAPP       240
     PPAPVPAPGP DVHAAQTIVA PMNTPPGGAP VPPPAPAPAP YGQPGQPGQQ PPYGQVLGQT       300
     APPPPGYGQP QAPQAPAPPP GYGQPTAPPG YGQQPGPPAA YGQQAPPPGY GQQPPQAMPR       360
     GAPQGAGVTA ALQQFRETPT GQRWTQQNKK LVRVDLGAEG QPVLARQGSM VLYQGKVDFS       420
     YKGAGFAGRV VGNATGQEMQ LMRCTGKGQV FLAENSAMLH PIELQGDAVC VSAENVLAFD       480
     ESLQYEVRRI EGHGIPGGAL FTMQFQGTGT VVVKTRGVPV VLPVTPTTFA DCNAVVAWSA       540
     AAQVVVSSQV RMRRNSYAGD TGESVNLQFR AAPGSFVVVQ PYEI                        584
//

If you have problems or comments...

PBIL Back to PBIL home page