(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5196

AL939122.SCO5196     Location/Qualifiers
FT   CDS             283920..284600
FT                   /transl_table=11
FT                   /gene="SCO5196"
FT                   /gene_synonym="2SC3B6.20"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.20, conserved hypothetical protein, len: 226
FT                   aa; similar to TR:CAB93731 (EMBL:AL357613) Streptomyces
FT                   coelicolor hypothetical 23.8 kD protein SC5F8.03c, 225 aa;
FT                   fasta scores: opt: 439 z-score: 523.3 E(): 1.1e-21; 37.8%
FT                   identity in 222 aa overlap"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ2"
FT                   /protein_id="CAC01326.1"
FT                   /translation="MNQPLAGYAPAPAGARMENHGNHMLKVAMQTGNDLLARVGSMTAY
FT                   EGFVQYEPNPPAVRQIAKDWMTGEGAPLMKCSGDGLLYLADYGANVVVINLNGDGISVN
FT                   ATNLLAFDAHLTWGVERVKGLAKFAGQGLWNTKISGQGWVALTSRGKPIVVDCGGGEDE
FT                   TYVDPDALVAWSPNLKVKGKRSFKAQSLIGRGSGEAFQMAFSGQGIVVVQPSEDSTDRL
FT                   RVRG"
     MNQPLAGYAP APAGARMENH GNHMLKVAMQ TGNDLLARVG SMTAYEGFVQ YEPNPPAVRQ        60
     IAKDWMTGEG APLMKCSGDG LLYLADYGAN VVVINLNGDG ISVNATNLLA FDAHLTWGVE       120
     RVKGLAKFAG QGLWNTKISG QGWVALTSRG KPIVVDCGGG EDETYVDPDA LVAWSPNLKV       180
     KGKRSFKAQS LIGRGSGEAF QMAFSGQGIV VVQPSEDSTD RLRVRG                      226
//

If you have problems or comments...

PBIL Back to PBIL home page