(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5198

AL939122.SCO5198     Location/Qualifiers
FT   CDS             complement(285433..285948)
FT                   /transl_table=11
FT                   /gene="SCO5198"
FT                   /gene_synonym="2SC3B6.22c"
FT                   /product="hypothetical protein"
FT                   /note="2SC3B6.22c, hypothetical protein, len: 171 aa; low
FT                   similarity to TR:Q9S2D5 (EMBL:AL110470) Streptomyces
FT                   coelicolor MutT domain containing protein, 204 aa; fasta
FT                   scores: opt: 139 z-score: 184.0 E(): 0.0088; 30.8% identity
FT                   in 120 aa overlap"
FT                   /db_xref="GOA:Q9FCJ0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCJ0"
FT                   /protein_id="CAC01328.1"
FT                   /translation="MSLHDDAVLVLKAYEGQDELRQVYLDHLATHPDGMWKACADGHVT
FT                   ASALVIDPSRERVLLTLHKKLRMWLQMGGHCEPVDETLARAALREGTEESGIAGLALLA
FT                   GGPVRLDRHHTPCAWHLDVQYAAVAPPGAVEAISDESLDLRWFPYAEVADVADDSVVRL
FT                   LEATRARL"
     MSLHDDAVLV LKAYEGQDEL RQVYLDHLAT HPDGMWKACA DGHVTASALV IDPSRERVLL        60
     TLHKKLRMWL QMGGHCEPVD ETLARAALRE GTEESGIAGL ALLAGGPVRL DRHHTPCAWH       120
     LDVQYAAVAP PGAVEAISDE SLDLRWFPYA EVADVADDSV VRLLEATRAR L                171
//

If you have problems or comments...

PBIL Back to PBIL home page