(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5199

AL939122.SCO5199     Location/Qualifiers
FT   CDS             complement(285945..287408)
FT                   /transl_table=11
FT                   /gene="SCO5199"
FT                   /gene_synonym="2SC3B6.23c"
FT                   /product="conserved hypothetical protein"
FT                   /note="2SC3B6.23c, conserved hypothetical protein, len: 487
FT                   aa; similar to TR:O53341 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis hypothetical 49.4 kD protein, 472 aa; fasta
FT                   scores: opt: 1382 z-score: 1331.8 E(): 0; 46.2% identity in
FT                   489 aa overlap"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCI9"
FT                   /protein_id="CAC01329.1"
FT                   /translation="MSDTPFGFGLPPEEPDDGDEGKKKDQQSGGGQGPANPFGFGMSGA
FT                   GGLGGPGADNPFAAMFGSMNPNDLGAAFQQLGQMLSYEGGPVNWDMAKQIARQTVSQGT
FT                   PDGRKDASVGPAERNAVQEAVRLADLWLDDATALPSGAGTAVAWSRAEWVEATLPAWRE
FT                   LVDPVAERVGNAMGDVLPEEMQAMAGPLIGMMRSMGGAMFGTQIGQAVGVLAGEVVGST
FT                   DVGLPLGPAGKAALLPANIESFGKDLGVPQEEVRLYLALREAAHQRLFAHVPWLRSHLF
FT                   GAVDGYARGIKVDTAKLEDVVGQFDPQNPEQLQEALQQGMFQPEDTPEQKAALARLETA
FT                   LALVEGWVDAVVHTAAKPRLSSADALRETLRRRRASGGPAEQTFATLIGLELRPRRLRD
FT                   ASRLWASLTDAHGVDGRDGLWAHPDMLPTATDLDDPDGFVHREQLDFSELDKMLGEAAG
FT                   KPDLKKKDEGDRGENRSADRDEPKGDDGE"
     MSDTPFGFGL PPEEPDDGDE GKKKDQQSGG GQGPANPFGF GMSGAGGLGG PGADNPFAAM        60
     FGSMNPNDLG AAFQQLGQML SYEGGPVNWD MAKQIARQTV SQGTPDGRKD ASVGPAERNA       120
     VQEAVRLADL WLDDATALPS GAGTAVAWSR AEWVEATLPA WRELVDPVAE RVGNAMGDVL       180
     PEEMQAMAGP LIGMMRSMGG AMFGTQIGQA VGVLAGEVVG STDVGLPLGP AGKAALLPAN       240
     IESFGKDLGV PQEEVRLYLA LREAAHQRLF AHVPWLRSHL FGAVDGYARG IKVDTAKLED       300
     VVGQFDPQNP EQLQEALQQG MFQPEDTPEQ KAALARLETA LALVEGWVDA VVHTAAKPRL       360
     SSADALRETL RRRRASGGPA EQTFATLIGL ELRPRRLRDA SRLWASLTDA HGVDGRDGLW       420
     AHPDMLPTAT DLDDPDGFVH REQLDFSELD KMLGEAAGKP DLKKKDEGDR GENRSADRDE       480
     PKGDDGE                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page