(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5200

AL939122.SCO5200     Location/Qualifiers
FT   CDS             287601..288722
FT                   /transl_table=11
FT                   /gene="SCO5200"
FT                   /gene_synonym="2SC3B6.24"
FT                   /product="putative membrane protein"
FT                   /note="2SC3B6.24, putative membrane protein, len: 373 aa;
FT                   similar to TR:Q9WX08 (EMBL:AL079345) Streptomyces
FT                   coelicolor putative epimerase SCE68.24c, 353 aa; fasta
FT                   scores: opt: 307 z-score: 353.0 E(): 3.4e-12; 29.1%
FT                   identity in 320 aa overlap. Contains possible N-terminal
FT                   region signal sequence peptide and possible hydrophobic
FT                   membrane spanning region at C-terminal domain"
FT                   /db_xref="GOA:Q9FCI8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCI8"
FT                   /protein_id="CAC01330.1"
FT                   /translation="MSSPDPQVRAARNQSTSSARPGARGPVVAVTGAASGVGALLTARL
FT                   AASDEVRQVVAIDERRGGCEAAQWQILDVRDPAIAEKLRGADVVVHLALDLDLETDAAA
FT                   RTAYNVRGTQTVLTAAAAAGVHRVVLCTSAMVYGALPDNELPLSEDAELRATAEATGVG
FT                   DLLEIERLARRAPRAHPGLNVTVVRPAVLVGGMDTALTRYFESPRLLVVAGSRPAWQFC
FT                   HVDDLCSALEYAVLEKADGELAVGCDGWLEQEEVEELSGIRRMELPSAVALGAAARLHR
FT                   IGLTPSPAGDLAYTMYPWVVSGSRLHDAGWRPKHTNEEVLAELLEEVSGRHTVAGRRLG
FT                   RKDATAAGAAGATVALLGAAAVVRRARKARRRI"
     MSSPDPQVRA ARNQSTSSAR PGARGPVVAV TGAASGVGAL LTARLAASDE VRQVVAIDER        60
     RGGCEAAQWQ ILDVRDPAIA EKLRGADVVV HLALDLDLET DAAARTAYNV RGTQTVLTAA       120
     AAAGVHRVVL CTSAMVYGAL PDNELPLSED AELRATAEAT GVGDLLEIER LARRAPRAHP       180
     GLNVTVVRPA VLVGGMDTAL TRYFESPRLL VVAGSRPAWQ FCHVDDLCSA LEYAVLEKAD       240
     GELAVGCDGW LEQEEVEELS GIRRMELPSA VALGAAARLH RIGLTPSPAG DLAYTMYPWV       300
     VSGSRLHDAG WRPKHTNEEV LAELLEEVSG RHTVAGRRLG RKDATAAGAA GATVALLGAA       360
     AVVRRARKAR RRI                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page