(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5201

AL939122.SCO5201     Location/Qualifiers
FT   CDS             288833..289291
FT                   /transl_table=11
FT                   /gene="SCO5201"
FT                   /gene_synonym="2SC3B6.25"
FT                   /product="moaE-like protein"
FT                   /note="2SC3B6.25, moaE-like protein, len: 152 aa; similar
FT                   to SW:MOAE_ECOLI (EMBL:X70420) Escherichia coli
FT                   molybdopterin [mpt] converting factor, subunit 2 MoaE, 149
FT                   aa; fasta scores: opt: 255 z-score: 317.2 E(): 3.3e-10;
FT                   33.3% identity in 129 aa overlap"
FT                   /db_xref="GOA:Q9FCI7"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCI7"
FT                   /protein_id="CAC01331.1"
FT                   /translation="MATTNDHPGERAAADPVKLIGIRETPLSVDEVFGAVGDDASGGTA
FT                   LFVGTVRNHDGGTDVDRLGYSCHPSAEAEMRRIAEKVVAEYPVRALAALHRVGDLEVGD
FT                   LAVVVAVSCPHRGEAFDACRKLIDDLKHEVPIWKHQTFSDGTEEWVGA"
     MATTNDHPGE RAAADPVKLI GIRETPLSVD EVFGAVGDDA SGGTALFVGT VRNHDGGTDV        60
     DRLGYSCHPS AEAEMRRIAE KVVAEYPVRA LAALHRVGDL EVGDLAVVVA VSCPHRGEAF       120
     DACRKLIDDL KHEVPIWKHQ TFSDGTEEWV GA                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page