(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5202

AL939122.SCO5202     Location/Qualifiers
FT   CDS             289650..290744
FT                   /transl_table=11
FT                   /gene="SCO5202"
FT                   /gene_synonym="2SC3B6.26"
FT                   /product="putative secreted protein"
FT                   /note="2SC3B6.26, possible secreted protein, len: 364 aa;
FT                   similar to TR:O53340 (EMBL:AL021646) Mycobacterium
FT                   tuberculosis hypothetical 35.5. kD protein, 340 aa; fasta
FT                   scores: opt: 430 z-score: 467.4 E(): 1.4e-18; 41.3%
FT                   identity in 361 aa overlap. Contains possible N-terminal
FT                   signal peptide sequence"
FT                   /db_xref="GOA:Q9FCI6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCI6"
FT                   /protein_id="CAC01332.1"
FT                   /translation="MPRRTATMLASTLMLIALLCAGVFIPVPYSEMSPGPTVNTLGDHD
FT                   GEPVLQISGHKTYEASGHLNMTTVRVTSAEYRMNLVEAVYGWLAHDNSVVPHETLYPDG
FT                   KTEEEATQENAEEFSQSQESAKVAALKALDIPVKSWVVVSAVVKDSPSQGRLHAGDVIK
FT                   AVDGTTVKKPADVAELVTKHEPGQDTVFTIVPAKEQAAAEKEGRTATKTQKITIRTETS
FT                   QDAGAQRAVVGISAGTDHTFPFEIDIKLADVGGPSAGLMFALGIYDKLTPGDLTGGKFV
FT                   AGTGTIDDNGKVGPIGGIGMKTIGAHDKGAQYFLTPADNCAAAAEDTPDGLTLVKVDTI
FT                   DDALGALKDIRSGKTADLPKCTQG"
     MPRRTATMLA STLMLIALLC AGVFIPVPYS EMSPGPTVNT LGDHDGEPVL QISGHKTYEA        60
     SGHLNMTTVR VTSAEYRMNL VEAVYGWLAH DNSVVPHETL YPDGKTEEEA TQENAEEFSQ       120
     SQESAKVAAL KALDIPVKSW VVVSAVVKDS PSQGRLHAGD VIKAVDGTTV KKPADVAELV       180
     TKHEPGQDTV FTIVPAKEQA AAEKEGRTAT KTQKITIRTE TSQDAGAQRA VVGISAGTDH       240
     TFPFEIDIKL ADVGGPSAGL MFALGIYDKL TPGDLTGGKF VAGTGTIDDN GKVGPIGGIG       300
     MKTIGAHDKG AQYFLTPADN CAAAAEDTPD GLTLVKVDTI DDALGALKDI RSGKTADLPK       360
     CTQG                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page