(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5203

AL939122.SCO5203     Location/Qualifiers
FT   CDS             complement(290775..291446)
FT                   /transl_table=11
FT                   /gene="SCO5203"
FT                   /gene_synonym="2SC3B6.27c"
FT                   /product="hypothetical protein 2SC3B6.27c"
FT                   /note="2SC3B6.27c, unknown, len: 223 aa. Contains two TTA
FT                   leucine codons, possible targets for bldA regulation"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FCI5"
FT                   /protein_id="CAC01333.1"
FT                   /translation="MIRQALGFAGPPCAPVIAGPHLCNLLIVYSVPDSGHERGRIVTMS
FT                   NTPMAASPLTRAVLEIDEYVSGLGWDQPARLFALVDTARLRADQPSLADRLGLREEPES
FT                   SGLTPIEQDEIPTDQALDEFLGTIAWPDSVVGCALAVERLMLPPSAEAQVPSGLNEKKL
FT                   AQWVAEHPDRQEVRMTVAVLRDGSRDSALRLREKDTATEVLTGSDLVPGLAAALTATFE
FT                   E"
     MIRQALGFAG PPCAPVIAGP HLCNLLIVYS VPDSGHERGR IVTMSNTPMA ASPLTRAVLE        60
     IDEYVSGLGW DQPARLFALV DTARLRADQP SLADRLGLRE EPESSGLTPI EQDEIPTDQA       120
     LDEFLGTIAW PDSVVGCALA VERLMLPPSA EAQVPSGLNE KKLAQWVAEH PDRQEVRMTV       180
     AVLRDGSRDS ALRLREKDTA TEVLTGSDLV PGLAAALTAT FEE                         223
//

If you have problems or comments...

PBIL Back to PBIL home page