(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5207

AL939122.SCO5207     Location/Qualifiers
FT   CDS             complement(297547..297984)
FT                   /transl_table=11
FT                   /gene="SCO5207"
FT                   /gene_synonym="SC7E4.04c"
FT                   /product="hypothetical protein SC7E4.04c"
FT                   /note="SC7E4.04c, hypothetical protein, len: 145 aa;
FT                   similar to TR:Q9YFH9 (EMBL:AP000058) Aeropyrum pernix
FT                   hypothetical 15.7 kD protein APE0267, 143 aa; fasta scores:
FT                   opt: 220 z-score: 282.8 E(): 2.8e-08; 34.1% identity in 126
FT                   aa overlap. Contains 2x Pfam match to entry PF00571 CBS,
FT                   CBS domain"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4B2"
FT                   /protein_id="CAB94592.1"
FT                   /translation="MDHRQEVAPPMLVREVMSTVVLTIGPAHTLRQAAALMSARRVGAA
FT                   VVYDPDAGGIGILTERDVLVSVGRGQDPDTERTHGHTTTDVVFAAPTWTVEEAAGAMAH
FT                   GGFRHLIVLDGGEPVGIVSVRDIIRRWAPARSPHNAPAVTA"
     MDHRQEVAPP MLVREVMSTV VLTIGPAHTL RQAAALMSAR RVGAAVVYDP DAGGIGILTE        60
     RDVLVSVGRG QDPDTERTHG HTTTDVVFAA PTWTVEEAAG AMAHGGFRHL IVLDGGEPVG       120
     IVSVRDIIRR WAPARSPHNA PAVTA                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page