(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5209

AL939122.SCO5209     Location/Qualifiers
FT   CDS             299080..299691
FT                   /transl_table=11
FT                   /gene="SCO5209"
FT                   /gene_synonym="SC7E4.06"
FT                   /product="putative tetR-family transcriptional regulator"
FT                   /note="SC7E4.06, possible tetR-family transcriptional
FT                   regulator, len: 203 aa; similar to TR:Q9Z551
FT                   (EMBL:AL035212) Streptomyces coelicolor putative
FT                   transcriptional regulator SC9B2.08c, 192 aa; fasta scores:
FT                   opt: 169 z-score: 206.9 E(): 0.00047; 31.9% identity in 182
FT                   aa overlap. Contains Pfam match to entry PF00440 tetR,
FT                   Bacterial regulatory proteins, tetR family and possible
FT                   helix-turn-helix motif at residues 24..45 (+3.85 SD)"
FT                   /db_xref="GOA:Q9K4B0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4B0"
FT                   /protein_id="CAB94594.1"
FT                   /translation="MPAARESLLDAAYTALARRPWSAVRMVDVAASAGVSRQTLYNEFG
FT                   SKEGLARALVRREADGYLAGVERALSGPSDPRERLTATAEWMMSAARDNALVRAMLTGC
FT                   WNERLPAPALTAVPSSCAVPAQRRADGPLPSPGDFVGLVRDRAVAVLGGAGPLPPPDAA
FT                   ELARSCELTVRLALSCVAAPPAEGGVADLVRTALPRRLTA"
     MPAARESLLD AAYTALARRP WSAVRMVDVA ASAGVSRQTL YNEFGSKEGL ARALVRREAD        60
     GYLAGVERAL SGPSDPRERL TATAEWMMSA ARDNALVRAM LTGCWNERLP APALTAVPSS       120
     CAVPAQRRAD GPLPSPGDFV GLVRDRAVAV LGGAGPLPPP DAAELARSCE LTVRLALSCV       180
     AAPPAEGGVA DLVRTALPRR LTA                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page