(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5210

AL939122.SCO5210     Location/Qualifiers
FT   CDS             complement(299723..300046)
FT                   /transl_table=11
FT                   /gene="SCO5210"
FT                   /gene_synonym="SC7E4.07c"
FT                   /product="putative molecular chaperone"
FT                   /note="SC7E4.07c, possible molecular chaperone, len: 107
FT                   aa; similar to SW:SUGE_ECOLI (EMBL:X69949) Escherichia coli
FT                   SugE protein, 105 aa; fasta scores: opt: 341 z-score: 449.1
FT                   E(): 1.5e-17; 44.7% identity in 103 aa overlap and to
FT                   TR:CAB88839 (EMBL:AL353832) Streptomyces coelicolor sugE,
FT                   SCE6.35c, 106 aa; fasta scores: opt: 323 z-score: 386.5
FT                   E(): 6e-16; 43.0% identity in 107 aa overlap. Contains Pfam
FT                   match to entry PF00893 DUF7, Integral membrane protein and
FT                   possible hydrophobic membrane spanning regions"
FT                   /db_xref="GOA:Q9K4A9"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A9"
FT                   /protein_id="CAB94595.1"
FT                   /translation="MAWLLVIVAGVLETGFAVCLKLSHGFTRLWPTIAFCAFALGSFGL
FT                   LTMSLKKLDVGPAYAVWTGIGAAGTAIYGMIFLGDLVSTLKIVSISFVIIGVIGLQLSG
FT                   SAH"
     MAWLLVIVAG VLETGFAVCL KLSHGFTRLW PTIAFCAFAL GSFGLLTMSL KKLDVGPAYA        60
     VWTGIGAAGT AIYGMIFLGD LVSTLKIVSI SFVIIGVIGL QLSGSAH                     107
//

If you have problems or comments...

PBIL Back to PBIL home page