(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5215

AL939122.SCO5215     Location/Qualifiers
FT   CDS             304326..304961
FT                   /transl_table=11
FT                   /gene="SCO5215"
FT                   /gene_synonym="SC7E4.12"
FT                   /product="hypothetical protein"
FT                   /note="SC7E4.12, hypothetical protein, len: 211 aa; similar
FT                   to TR:P96267 (EMBL:Z84724) Mycobacterium tuberculosis
FT                   hypothetical 21.7 kD protein MTCY22G10.18c, 209 aa; fasta
FT                   scores: opt: 255 z-score: 287.1 E(): 1.6e-08; 29.8%
FT                   identity in 205 aa overlap"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A4"
FT                   /protein_id="CAB94600.1"
FT                   /translation="MTEAVETDAGPARITWHRAKQPRLVLAVSHGAGGGIEARDLKALA
FT                   AALPAHGVSVALVEQPWRVAGRKLAPAPKTLDTGWRGVWPALAAPGLPVISGGRSAGAR
FT                   VACRTAGELGARAVLALSFPLHPPGRPEKSRADELLGAGVPTLVVQGGNDPFGRPHEFP
FT                   EAPGGTYDLIEVPYGDHGFAVPKRAEISQERALELITDGVAQWAGSLG"
     MTEAVETDAG PARITWHRAK QPRLVLAVSH GAGGGIEARD LKALAAALPA HGVSVALVEQ        60
     PWRVAGRKLA PAPKTLDTGW RGVWPALAAP GLPVISGGRS AGARVACRTA GELGARAVLA       120
     LSFPLHPPGR PEKSRADELL GAGVPTLVVQ GGNDPFGRPH EFPEAPGGTY DLIEVPYGDH       180
     GFAVPKRAEI SQERALELIT DGVAQWAGSL G                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page