(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5216

AL939122.SCO5216     Location/Qualifiers
FT   CDS             305219..305902
FT                   /transl_table=11
FT                   /gene="SCO5216"
FT                   /gene_synonym="sigR"
FT                   /gene_synonym="SC7E4.13"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="SC7E4.13, sigR, RNA polymerase sigma factor, len:
FT                   227 aa; identical to previously sequenced TR:O87834
FT                   (EMBL:AJ010320) Streptomyces coelicolor RNA polymerase
FT                   sigma factor SigR, 227 aa. Contains Pfam match to entry
FT                   PF00776 Sigma70_ECF, Sigma-70 factor (ECF subfamily) and
FT                   match to Prosite entry PS01063 Sigma-70 factors ECF
FT                   subfamily signature. Contains also possible
FT                   helix-turn-helix motif at residues 171..192 (+2.53 SD)"
FT                   /db_xref="GOA:Q7AKG9"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014293"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="PDB:1H3L"
FT                   /db_xref="PDB:5FGM"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7AKG9"
FT                   /protein_id="CAB94601.1"
FT                   /translation="MGPVTGTDAGTEHGQAEQPEGRGTGAESTAERSARFERDALEFLD
FT                   QMYSAALRMTRNPADAEDLVQETYAKAYASFHQFREGTNLKAWLYRILTNTFINSYRKK
FT                   QREPQRSAAEEIEDWQLARAESHMSTGLRSAESQALDHLPDSDVKQALQAIPEEFRIAV
FT                   YLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYARDRGLVPAGAGESNEA
FT                   KGSGS"
     MGPVTGTDAG TEHGQAEQPE GRGTGAESTA ERSARFERDA LEFLDQMYSA ALRMTRNPAD        60
     AEDLVQETYA KAYASFHQFR EGTNLKAWLY RILTNTFINS YRKKQREPQR SAAEEIEDWQ       120
     LARAESHMST GLRSAESQAL DHLPDSDVKQ ALQAIPEEFR IAVYLADVEG FAYKEIADIM       180
     GTPIGTVMSR LHRGRRQLRG MLEDYARDRG LVPAGAGESN EAKGSGS                     227
//

If you have problems or comments...

PBIL Back to PBIL home page