(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5218

AL939122.SCO5218     Location/Qualifiers
FT   CDS             306345..307670
FT                   /transl_table=11
FT                   /gene="SCO5218"
FT                   /gene_synonym="SC7E4.15"
FT                   /product="putative integral membrane protein"
FT                   /note="SC7E4.15, possible integral membrane protein, len:
FT                   441 aa; similar to TR:Q9X1H8 (EMBL:AE001797) Thermotoga
FT                   maritima conserved hypothetical protein TM1467, 426 aa;
FT                   fasta scores: opt: 471 z-score: 536.1 E(): 2.2e-22; 29.0%
FT                   identity in 352 aa overlap. Contains possible N-terminal
FT                   signal peptide sequence and possible hydrophobic membrane
FT                   spanning regions"
FT                   /db_xref="GOA:Q9K4A3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A3"
FT                   /protein_id="CAB94603.1"
FT                   /translation="MDAVPARARVYVAVVALTALLCLRPLPAVRAPWWAVLLLAGLYAG
FT                   SELVARSRFVGTCYPVLLAGAFLLPPPAAALVALPGALLAPVPRRPLGLRRVWRAAQLT
FT                   LAVWAAACVHWRLGGRDAVVEPAFPYALVPAGAAVLAFCLVLTVLDGGILTLADHVPPS
FT                   RAWRGLLSRSLAPIAVHGLAGLMMAVLWRSPYGPVAALLVLLPMCVAWWAFAQYHRERA
FT                   AHQATIRALVQAVDIKDGYTRGHSERVGQASMMIARELGMDDERVETLRFAGILHDVGK
FT                   LGVPTRLLRKDGPLTPEERRVIELHPEYGHEMVRGIRFLGEARAAVLHHHERLDGSGYP
FT                   YGLAGDRIPESARVVAVADAFDAMTSTRSYSRARPVATALAELQRCAGGQFDPRMVRAL
FT                   VRALGRHGWRPSVTADSPLTRTAGPAPDRGEDARDSVGRGAP"
     MDAVPARARV YVAVVALTAL LCLRPLPAVR APWWAVLLLA GLYAGSELVA RSRFVGTCYP        60
     VLLAGAFLLP PPAAALVALP GALLAPVPRR PLGLRRVWRA AQLTLAVWAA ACVHWRLGGR       120
     DAVVEPAFPY ALVPAGAAVL AFCLVLTVLD GGILTLADHV PPSRAWRGLL SRSLAPIAVH       180
     GLAGLMMAVL WRSPYGPVAA LLVLLPMCVA WWAFAQYHRE RAAHQATIRA LVQAVDIKDG       240
     YTRGHSERVG QASMMIAREL GMDDERVETL RFAGILHDVG KLGVPTRLLR KDGPLTPEER       300
     RVIELHPEYG HEMVRGIRFL GEARAAVLHH HERLDGSGYP YGLAGDRIPE SARVVAVADA       360
     FDAMTSTRSY SRARPVATAL AELQRCAGGQ FDPRMVRALV RALGRHGWRP SVTADSPLTR       420
     TAGPAPDRGE DARDSVGRGA P                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page