(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5220

AL939122.SCO5220     Location/Qualifiers
FT   CDS             309047..310027
FT                   /transl_table=11
FT                   /gene="SCO5220"
FT                   /gene_synonym="SC7E4.17"
FT                   /product="hypothetical protein SC7E4.17"
FT                   /note="SC7E4.17, unknown, len: 326 aa"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q9K4A1"
FT                   /protein_id="CAB94605.1"
FT                   /translation="MRIFGKARHRPSASWRQATDRAFTLIGDGRYEDAGALLTRAADLE
FT                   PWLSESWFNLALLHKFRHDWEQARAAGLRAVALLDRDIGAPDWWNVGIAATALQDWPLA
FT                   RRAWQAYGLRTPGGATDAGEPLGMDLGSAAVRLSPEGEAEVVWGRRLDPARVEVLSIPL
FT                   PSSGRRWGEVVLHDGVPHGERTTSAGHSYPVFDEIELWAPSPVPTWVVLLEAATESDRD
FT                   ALEQLAADAGFAAEDWSSSVRLLCRMCSESRMPSDEGDGEHLDPHDHSEPGHPGPLGHR
FT                   TDGQLWVPERECGVAAPAGLVKGLLDGWVADSPDSRDWRDLEEVC"
     MRIFGKARHR PSASWRQATD RAFTLIGDGR YEDAGALLTR AADLEPWLSE SWFNLALLHK        60
     FRHDWEQARA AGLRAVALLD RDIGAPDWWN VGIAATALQD WPLARRAWQA YGLRTPGGAT       120
     DAGEPLGMDL GSAAVRLSPE GEAEVVWGRR LDPARVEVLS IPLPSSGRRW GEVVLHDGVP       180
     HGERTTSAGH SYPVFDEIEL WAPSPVPTWV VLLEAATESD RDALEQLAAD AGFAAEDWSS       240
     SVRLLCRMCS ESRMPSDEGD GEHLDPHDHS EPGHPGPLGH RTDGQLWVPE RECGVAAPAG       300
     LVKGLLDGWV ADSPDSRDWR DLEEVC                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page