(data stored in ACNUC1104 zone)

EMBL: AL939122.SCO5221

AL939122.SCO5221     Location/Qualifiers
FT   CDS             310107..310757
FT                   /transl_table=11
FT                   /gene="SCO5221"
FT                   /gene_synonym="SC7E4.18"
FT                   /product="putative polypeptide deformylase"
FT                   /note="SC7E4.18, probable polypeptide deformylase, len: 216
FT                   aa; similar to SW:DEF_FREDI (EMBL:Y10305) Fremyella
FT                   diplosiphon polypeptide deformylase (EC 3.5.1.31) Def, 187
FT                   aa; fasta scores: opt: 353 z-score: 430.0 E(): 1.8e-16;
FT                   33.8% identity in 145 aa overlap and to TR:Q9XAQ2
FT                   (EMBL:AL078618) Streptomyces coelicolor putative
FT                   polypeptide deformylase SC10A7.23, 208 aa; fasta scores:
FT                   opt: 680 z-score: 796.7 E(): 0; 59.8% identity in 169 aa
FT                   overlap. Contains Pfam match to entry PF01327
FT                   Pep_deformylase, Polypeptide deformylase"
FT                   /db_xref="GOA:Q9K4A0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9K4A0"
FT                   /protein_id="CAB94606.1"
FT                   /translation="MAQQDTDQQHPGVLPVDDEGFVVDSQDCEEREADWRGRGTSRPIT
FT                   VVGNPVLHKECEDVTDFGEEFQQLVADMFASQRTAEGVGLAANQIGVSKKVFVYDCPDD
FT                   EGVRHVGVVCNPRLVELPADRRRLDDSNEGCLSVPTAYAPLARPDYAEVTGQDEKGNPV
FT                   KVRGTGYFARCLQHETDHLYGYLYIDRLSKRERKDALRQMAENEPRYPVVAND"
     MAQQDTDQQH PGVLPVDDEG FVVDSQDCEE READWRGRGT SRPITVVGNP VLHKECEDVT        60
     DFGEEFQQLV ADMFASQRTA EGVGLAANQI GVSKKVFVYD CPDDEGVRHV GVVCNPRLVE       120
     LPADRRRLDD SNEGCLSVPT AYAPLARPDY AEVTGQDEKG NPVKVRGTGY FARCLQHETD       180
     HLYGYLYIDR LSKRERKDAL RQMAENEPRY PVVAND                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page