(data stored in ACNUC27125 zone)

EMBL: AL954360.FAM21B

AL954360.FAM21B      Location/Qualifiers
FT   CDS             join(<2096..2158,4180..4353,7475..7568,8905..8966,
FT                   10683..10730,14202..14312,14857..14944,15588..15659,
FT                   16694..16812,17286..17343,18573..18632,19024..19203,
FT                   21100..21227,23402..23488,27466..27567,29759..29890,
FT                   33527..33696,37319..37421,41331..41483,43012..43194,
FT                   48542..48670,48798..48878,49486..49608,51012..51224,
FT                   52848..53468,54333..54510,56238..56377)
FT                   /codon_start=1
FT                   /gene="FAM21B"
FT                   /locus_tag="RP11-98I6.1-002"
FT                   /standard_name="OTTHUMP00000019527"
FT                   /product="family with sequence similarity 21, member B"
FT                   /note="match: proteins: Sw:Q9Y4E1"
FT                   /db_xref="GOA:Q641Q2"
FT                   /db_xref="HGNC:HGNC:23416"
FT                   /db_xref="InterPro:IPR029341"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q641Q2"
FT                   /protein_id="CAI17187.1"
FT                   /translation="RVYDEEVEEPVLKAEAEKTEQEKTREQKEVDLIPKVQEAVNYGLQ
FT                   VLDSAFEQLDIKAGNSDSEEDDANGRVELILEPKDLYIDRPLPYLIGSKLFMEQEDVGL
FT                   GELSSEEGSVGSDRGSIVDTEEEKEEEESDEDFAHHSDNEQNRHTTQMSDEEEDDDGCD
FT                   LFADSEKEEEDIEDIEENTRPKRSRPTSFADELAARIKGDAVGRVDEEPTTLPSGEAKP
FT                   RKTLKEKKERRTPSDDEEDNLFTPPKLTDEDFSPFGSGGGLFSGGKGLFDDEDEESDLF
FT                   TEAPQDRQAGASVKEESSSSKPGKKIPAGAVSVFLGDTDVFGAASVPSMKEPQKPEQPT
FT                   PRKSPYGPPPTGLFDDDDGDDDDDFFSAPHSKPSKTGKVQSTADIFGDEEGDLFKEKAV
FT                   ASPEATVSQTDENKARAEKKVTLSSSKNLKPSSETKTQKGLFSDEEDSEDLFSSQSASK
FT                   LKGASLLPGKLPTSVSLFDDEDEEDNLFGGTAAKKQTLCLQAQREEKAKASELSKKKAS
FT                   ALLFSSDEEDQWNIPASQTHLASDSRSKGEPRDSGTLQSQEAKAVKKTSLFEEDEEDDL
FT                   FAIAKDSQKKTQRVSLLFEDDVDSRGSLFGSPPTSVPPATKKKETVSEAPPLLFSDEEE
FT                   KEAQLGVKSVDKKVESAKESLKFGRTDVAESEKEGLLTRSAQETVKHSDLFSSSSPWDK
FT                   GTKPRTKTVLSLFDEEEDKMEDQNIIQAPQKEVGKGRDPDAHPKSTGVFQDEELLFSHK
FT                   LQKDNDPDVDLFAGTKKTKLLEPSVGSLFGDDEDDDLFSSAKSQPLVQEKKRVVKKDHS
FT                   VDSFKNQKHPESIQGSKEKGIWKPETPQANLAINPAALLPTAASQISEVKPVLPELAFP
FT                   SSEHRRSHGLESVPVLPGSGEAGVSFDLPAQADTLHSANKSRVKMRGKRRPQTRAARRL
FT                   AAQESSETEDMSVPRGPIAQWADGAISPNGHRPQLRAASGEDSTEEALAAAAAPWEGGP
FT                   VPGVDRSPFAKSLGHSRGEADLFDSGDIFSTGTGSQSVERTKPKAKIAENPANPPVGGK
FT                   AKSPMFPALGEASSDDDLFQSAKPKPAKKTNTFPLLEDEDDLFTDQKVKKNETKSNSQQ
FT                   DVILTTQDIFEDDIFATEAIKPSQKTREKEKTLESNLFDDNIDIFADLTVKPKEKSKKK
FT                   VEAKSIFDDDMDDIFSSGIQAKTTKPKSRSAQAAPEPRFEHKVSNIFDDPLNAFGGQ"
     RVYDEEVEEP VLKAEAEKTE QEKTREQKEV DLIPKVQEAV NYGLQVLDSA FEQLDIKAGN        60
     SDSEEDDANG RVELILEPKD LYIDRPLPYL IGSKLFMEQE DVGLGELSSE EGSVGSDRGS       120
     IVDTEEEKEE EESDEDFAHH SDNEQNRHTT QMSDEEEDDD GCDLFADSEK EEEDIEDIEE       180
     NTRPKRSRPT SFADELAARI KGDAVGRVDE EPTTLPSGEA KPRKTLKEKK ERRTPSDDEE       240
     DNLFTPPKLT DEDFSPFGSG GGLFSGGKGL FDDEDEESDL FTEAPQDRQA GASVKEESSS       300
     SKPGKKIPAG AVSVFLGDTD VFGAASVPSM KEPQKPEQPT PRKSPYGPPP TGLFDDDDGD       360
     DDDDFFSAPH SKPSKTGKVQ STADIFGDEE GDLFKEKAVA SPEATVSQTD ENKARAEKKV       420
     TLSSSKNLKP SSETKTQKGL FSDEEDSEDL FSSQSASKLK GASLLPGKLP TSVSLFDDED       480
     EEDNLFGGTA AKKQTLCLQA QREEKAKASE LSKKKASALL FSSDEEDQWN IPASQTHLAS       540
     DSRSKGEPRD SGTLQSQEAK AVKKTSLFEE DEEDDLFAIA KDSQKKTQRV SLLFEDDVDS       600
     RGSLFGSPPT SVPPATKKKE TVSEAPPLLF SDEEEKEAQL GVKSVDKKVE SAKESLKFGR       660
     TDVAESEKEG LLTRSAQETV KHSDLFSSSS PWDKGTKPRT KTVLSLFDEE EDKMEDQNII       720
     QAPQKEVGKG RDPDAHPKST GVFQDEELLF SHKLQKDNDP DVDLFAGTKK TKLLEPSVGS       780
     LFGDDEDDDL FSSAKSQPLV QEKKRVVKKD HSVDSFKNQK HPESIQGSKE KGIWKPETPQ       840
     ANLAINPAAL LPTAASQISE VKPVLPELAF PSSEHRRSHG LESVPVLPGS GEAGVSFDLP       900
     AQADTLHSAN KSRVKMRGKR RPQTRAARRL AAQESSETED MSVPRGPIAQ WADGAISPNG       960
     HRPQLRAASG EDSTEEALAA AAAPWEGGPV PGVDRSPFAK SLGHSRGEAD LFDSGDIFST      1020
     GTGSQSVERT KPKAKIAENP ANPPVGGKAK SPMFPALGEA SSDDDLFQSA KPKPAKKTNT      1080
     FPLLEDEDDL FTDQKVKKNE TKSNSQQDVI LTTQDIFEDD IFATEAIKPS QKTREKEKTL      1140
     ESNLFDDNID IFADLTVKPK EKSKKKVEAK SIFDDDMDDI FSSGIQAKTT KPKSRSAQAA      1200
     PEPRFEHKVS NIFDDPLNAF GGQ                                              1223
//

If you have problems or comments...

PBIL Back to PBIL home page