(data stored in ACNUC27125 zone)

EMBL: AL954360.PE2

AL954360.PE2         Location/Qualifiers
FT   CDS             join(<48804..48878,49486..49608,50589..50651,51012..51224,
FT                   52848..>53200)
FT                   /codon_start=1
FT                   /gene="FAM21B"
FT                   /locus_tag="RP11-98I6.1-003"
FT                   /standard_name="OTTHUMP00000019528"
FT                   /product="family with sequence similarity 21, member B"
FT                   /db_xref="InterPro:IPR029341"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SNT8"
FT                   /protein_id="CAI17188.1"
FT                   /translation="EPSVGSLFGDDEDDDLFSSAKSQPLVQEKKRVVKKDHSVDSFKNQ
FT                   KHPESIQGSKEKGIWKPETPQDSSGLAPFKTKEPSTRIGKIQANLAINPAALLPTAASQ
FT                   ISEVKPVLPELAFPSSEHRRSHGLESVPVLPGSGEAGVSFDLPAQADTLHSANKSRVKM
FT                   RGKRRPQTRAARRLAAQESSETEDMSVPRGPIAQWADGAISPNGHRPQLRAASGEDSTE
FT                   EALAAAAAPWEGGPVPGVDRSPFAKSLGHSRGEADLFDSGDIFSTGTGSQSVE"
     EPSVGSLFGD DEDDDLFSSA KSQPLVQEKK RVVKKDHSVD SFKNQKHPES IQGSKEKGIW        60
     KPETPQDSSG LAPFKTKEPS TRIGKIQANL AINPAALLPT AASQISEVKP VLPELAFPSS       120
     EHRRSHGLES VPVLPGSGEA GVSFDLPAQA DTLHSANKSR VKMRGKRRPQ TRAARRLAAQ       180
     ESSETEDMSV PRGPIAQWAD GAISPNGHRP QLRAASGEDS TEEALAAAAA PWEGGPVPGV       240
     DRSPFAKSLG HSRGEADLFD SGDIFSTGTG SQSVE                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page