(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE1

ALDEN1_2.PE1         Location/Qualifiers
FT   CDS             206..1627
FT                   /locus_tag="Alide_0001"
FT                   /gene_family="HOG000235659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein dnaa"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   dia:Dtpsy_0001 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="GI:319760739"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003688"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="GeneID:10106510"
FT                   /translation="MHEGPSHSSHDTDGDSAGQGLWQACTEQLAQDLPEQQFNTWIKPL
FT                   VAQVSPDFSKVTLLVANRFKLDWIRAQYAGRISALLEELYGQPVTLELALAQRESVART
FT                   YVRPVPASIEAPAANAPAGAAAEEPPAGAFRTRLNLALTFDTLVEGTANRMARSAAMHV
FT                   AGSPGHLYNPLFIYGGVGLGKTHLVHAVGNKLLADRPDAKVLYIHAEQFVSDVVKSYQR
FT                   RTFDDFKERYHSLDLLLIDDVQFFANKDRTQEEFFNAFEALLAKKSHIVMTSDTYPKGL
FT                   ANIHERLVSRFDSGLTVAIEPPELEMRVAILINKARAEHAEMPEEVAFFVAKNVRSNVR
FT                   ELEGALRKILAYSRFNQKEVSIQLAREALRDLLSIQNRQISVENIQKTVADYYKIKVAD
FT                   MYSKKRPASIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIGAERQQLT
FT                   ELNQQLHVLEQTLKG"
FT                   /protein_id="YP_004124676.1"
     MHEGPSHSSH DTDGDSAGQG LWQACTEQLA QDLPEQQFNT WIKPLVAQVS PDFSKVTLLV        60
     ANRFKLDWIR AQYAGRISAL LEELYGQPVT LELALAQRES VARTYVRPVP ASIEAPAANA       120
     PAGAAAEEPP AGAFRTRLNL ALTFDTLVEG TANRMARSAA MHVAGSPGHL YNPLFIYGGV       180
     GLGKTHLVHA VGNKLLADRP DAKVLYIHAE QFVSDVVKSY QRRTFDDFKE RYHSLDLLLI       240
     DDVQFFANKD RTQEEFFNAF EALLAKKSHI VMTSDTYPKG LANIHERLVS RFDSGLTVAI       300
     EPPELEMRVA ILINKARAEH AEMPEEVAFF VAKNVRSNVR ELEGALRKIL AYSRFNQKEV       360
     SIQLAREALR DLLSIQNRQI SVENIQKTVA DYYKIKVADM YSKKRPASIA RPRQIAMYLA       420
     KELTQKSLPE IGELFGGRDH TTVLHAVRKI GAERQQLTEL NQQLHVLEQT LKG              473
//

If you have problems or comments...

PBIL Back to PBIL home page